Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pro-neuropeptide Y (Npy), partial

Product Specifications

Product Name Alternative

Pro-neuropeptide Y [Cleaved into: Neuropeptide Y (Neuropeptide tyrosine) (NPY) ; C-flanking peptide of NPY (CPON) ]

Abbreviation

Recombinant Mouse Npy protein, partial

Gene Name

Npy

UniProt

P57774

Expression Region

29-64aa

Organism

Mus musculus (Mouse)

Target Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Tag

N-terminal hFc-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.9 kDa

References & Citations

"Behavioral characterization of neuropeptide Y knockout mice." Bannon A.W., Seda J., Carmouche M., Francis J.M., Norman M.H., Karbon B., McCaleb M.L. Brain Res 868:79-87 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PHF11 siRNA
abx903985-01 15 nmol

Human PHF11 siRNA

Sign In for Pricing
View Details
Human PHF11 siRNA
abx903985-02 30 nmol

Human PHF11 siRNA

Sign In for Pricing
View Details
HMGN2 Human Pre-designed siRNA Set A
HY-RS06244 1 Set

HMGN2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Synaptogyrin 2 Blocking Peptide
33R-2727 0.1 mg

Synaptogyrin 2 Blocking Peptide

Sign In for Pricing
View Details
SCG2 Antibody
A34189-100UL 100 µL

SCG2 Antibody

Sign In for Pricing
View Details
ZNF826P (Putative Zinc Finger Protein 826, Zinc Finger Protein 826, Pseudogene)
496894 100 µL

ZNF826P (Putative Zinc Finger Protein 826, Zinc Finger Protein 826, Pseudogene)

Sign In for Pricing
View Details