Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIP30 Protein, Human (His)

The NIP30 protein negatively regulates proteasomal protein catabolism and protein binding activity. It is located in the nucleus and is expressed in various tissues including the brain and testis. NIP30 Protein, Human (HEK293, His) is the recombinant human-derived NIP30 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NIP30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nip30-protein-human-hek293-his.html

Purity

95

Smiles

MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP

Molecular Formula

80011 (Gene_ID) NP_079222 (M1-P254) (Accession)

Molecular Weight

Approximately 35-43 kDa due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC26A2 Double Nickase Plasmid (m2)
sc-420071-NIC-2 20 µg

SLC26A2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
GRAMD2 Rabbit Polyclonal Antibody (HRP)
orb481995 100 µL

GRAMD2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
MRGPRF Human Over-expression Lysate
orb1364498 20 µg

MRGPRF Human Over-expression Lysate

Sign In for Pricing
View Details
5- (and-6) -Carboxy SNARF-4F Succinimidyl Ester
21171-AAT 10x 50 µg

5- (and-6) -Carboxy SNARF-4F Succinimidyl Ester

Sign In for Pricing
View Details
AREG Antibody
GWB-ML015F 50 µg

AREG Antibody

Sign In for Pricing
View Details
LOC440014 siRNA (h)
sc-105718 10 µM

LOC440014 siRNA (h)

Sign In for Pricing
View Details