Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus tubingensis Epoxide hydrolase

Product Specifications

Abbreviation

Recombinant Aspergillus tubingensis Epoxide hydrolase protein

UniProt

T2FEN1

Expression Region

1-395aa

Organism

Aspergillus tubingensis

Target Sequence

MALAHSNIPSGTTVIPSPFQVHVSDEQIEELQLLVKLSKLAPPTYEGLQQDRKYGITNEWLANAKEAWKSLDWRSAESRINSFPQFTYDIEGLTIHFVALFSERKDAIPIVLLHGWPGSFLEFLPALTSIRDKYSPETLPYHIVIPSLPGFTFSSGPPLDVNFTGVDTARVINKVMLNLGFEDGYVAQGGDIGSRIGRILAVDHESCKAVHLNACYMGKPSNVPDTAITEEDKRALARAQWFGTYGSGYALEHGTRPSTIGNVLSTNPVALLAWIGEKFLDWADEAVPLESILESVSLYWFTETFPRSIYHYRENVPPPKLRQAEDPRWYIRKPFGFSYYPKELVPTPRAWVETTGNLVFWQAHEKGGHFAALERPQDFLNDLTAFCEQVWAGRK

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.5 kDa

References & Citations

"Cloning and expression of an epoxide hydrolase gene from Aspergillus Tubingensis NJA-1 and characterization of its recombinant protein for deoxynivalenol biotransformation." Ren Z., He C. Submitted (MAY-2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-100 1x 100 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54), CF740 conjugate, 0.1mg/mL
BNC740054-100 1x 100 µL

HCG-beta (HCGb/54), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF568 conjugate, 0.1mg/mL
BNC682067-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (GM022), CF488A conjugate, 0.1mg/mL
BNC880874-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (GM022), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details