Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-7, Human (HEK293, His, solution)

Kallikrein-7 Protein (KLK7), a member of the tissue kallikrein family, is a first protease target of vaspin inhibited by classical serpin mechanism with high specificity in vitro. KLK7 cleaves human insulin in the A- and B-chain. KLK7 a serine protease with chymotrypsin-like activity which was involved in the regulated desquamation of terminally differentiated keratinocytes. KLK7 mediates the disruption of corneodesmosomes, the cell–cell adhesion junctions of corneocyites, by hydrolyzing the two mayor cadherins (corneodesmosin and desmocollin 1) in the extracellular region of these junctions. KLK7 overexpression and/or increased activity result in over-desquamation[1][2][3]. Kallikrein-7 Protein, Human (HEK293, His, solution) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-7 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-7-protein-human-hek-293-his.html

Purity

98.0

Smiles

EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKH

Molecular Formula

5650 (Gene_ID) AAH32005 (E23-H252) (Accession)

Molecular Weight

Approximately 28-32 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,25-Dihydroxyvitamin D3 (DHVD3) ELISA Kit
EKU08306 96 Tests

1,25-Dihydroxyvitamin D3 (DHVD3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal PIP Antibody (PIP/9076R) [Alexa Fluor 647]
NBP3-24017AF647 0.1 mL

Rabbit Monoclonal PIP Antibody (PIP/9076R) [Alexa Fluor 647]

Sign In for Pricing
View Details
PCAF (KAT2B, PCAF, Histone Acetyltransferase KAT2B, Histone Acetyltransferase PCAF, Lysine Acetyltransferase 2B, P300/CBP-associated Factor, GCN5, GCN5L) (HRP)
130925-HRP 100 µL

PCAF (KAT2B, PCAF, Histone Acetyltransferase KAT2B, Histone Acetyltransferase PCAF, Lysine Acetyltransferase 2B, P300/CBP-associated Factor, GCN5, GCN5L) (HRP)

Sign In for Pricing
View Details
AdmiRa-hsa-miR-6757-3p Virus
mh2387 250 µL

AdmiRa-hsa-miR-6757-3p Virus

Sign In for Pricing
View Details
LOC100503181 3'UTR Luciferase Stable Cell Line
TU111729 1.0 mL

LOC100503181 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Renalase Rabbit mAb
A19797 500 µL

Renalase Rabbit mAb

Sign In for Pricing
View Details