Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-7, Human (HEK293, His, solution)

Kallikrein-7 Protein (KLK7), a member of the tissue kallikrein family, is a first protease target of vaspin inhibited by classical serpin mechanism with high specificity in vitro. KLK7 cleaves human insulin in the A- and B-chain. KLK7 a serine protease with chymotrypsin-like activity which was involved in the regulated desquamation of terminally differentiated keratinocytes. KLK7 mediates the disruption of corneodesmosomes, the cell–cell adhesion junctions of corneocyites, by hydrolyzing the two mayor cadherins (corneodesmosin and desmocollin 1) in the extracellular region of these junctions. KLK7 overexpression and/or increased activity result in over-desquamation[1][2][3]. Kallikrein-7 Protein, Human (HEK293, His, solution) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-7 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-7-protein-human-hek-293-his.html

Purity

98.0

Smiles

EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKH

Molecular Formula

5650 (Gene_ID) AAH32005 (E23-H252) (Accession)

Molecular Weight

Approximately 28-32 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXB3, ID (HOXB3, HOX2G, Homeobox protein Hox-B3, Homeobox protein Hox-2.7, Homeobox protein Hox-2G) (FITC) discontinued
036699-FITC 200 µL

HOXB3, ID (HOXB3, HOX2G, Homeobox protein Hox-B3, Homeobox protein Hox-2.7, Homeobox protein Hox-2G) (FITC) discontinued

Sign In for Pricing
View Details
1810054G18Rik (BC013546) Mouse Tagged Lenti ORF Clone
MR202810L4 10 µg

1810054G18Rik (BC013546) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OR13J1, CT (OR13J1, Olfactory receptor 13J1, Olfactory receptor OR9-2) (MaxLight 750) discontinued
039325-ML750 100 µL

OR13J1, CT (OR13J1, Olfactory receptor 13J1, Olfactory receptor OR9-2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
WAVE2, Phosphorylated (Ser343) (Wiskott-Aldrich Syndrome Protein Family Member 2, WASP Family Protein Member 2, Protein WAVE-2, Verprolin Homology Domain-containing Protein 2, WASF2) (HRP)
MBS6270214-01 0.1 mL

WAVE2, Phosphorylated (Ser343) (Wiskott-Aldrich Syndrome Protein Family Member 2, WASP Family Protein Member 2, Protein WAVE-2, Verprolin Homology Domain-containing Protein 2, WASF2) (HRP)

Sign In for Pricing
View Details
WAVE2, Phosphorylated (Ser343) (Wiskott-Aldrich Syndrome Protein Family Member 2, WASP Family Protein Member 2, Protein WAVE-2, Verprolin Homology Domain-containing Protein 2, WASF2) (HRP)
MBS6270214-02 5x 0.1 mL

WAVE2, Phosphorylated (Ser343) (Wiskott-Aldrich Syndrome Protein Family Member 2, WASP Family Protein Member 2, Protein WAVE-2, Verprolin Homology Domain-containing Protein 2, WASF2) (HRP)

Sign In for Pricing
View Details
Human mucosae associated epithelia chemokine,MEC ELISA Kit
CN-03296H2 48T

Human mucosae associated epithelia chemokine,MEC ELISA Kit

Sign In for Pricing
View Details