Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-7, Human (HEK293, His, solution)

Kallikrein-7 Protein (KLK7), a member of the tissue kallikrein family, is a first protease target of vaspin inhibited by classical serpin mechanism with high specificity in vitro. KLK7 cleaves human insulin in the A- and B-chain. KLK7 a serine protease with chymotrypsin-like activity which was involved in the regulated desquamation of terminally differentiated keratinocytes. KLK7 mediates the disruption of corneodesmosomes, the cell–cell adhesion junctions of corneocyites, by hydrolyzing the two mayor cadherins (corneodesmosin and desmocollin 1) in the extracellular region of these junctions. KLK7 overexpression and/or increased activity result in over-desquamation[1][2][3]. Kallikrein-7 Protein, Human (HEK293, His, solution) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-7 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-7-protein-human-hek-293-his.html

Purity

98.0

Smiles

EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKH

Molecular Formula

5650 (Gene_ID) AAH32005 (E23-H252) (Accession)

Molecular Weight

Approximately 28-32 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mpi (NM_025837) Mouse Tagged ORF Clone Lentiviral Particle
MR206725L3V 200 µL

Mpi (NM_025837) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human CHD8 shRNA (UAS) - Lentiviral human CHD8 shRNA (UAS, RFP) plasmid
GTR15136489 1 Vial

Lentiviral human CHD8 shRNA (UAS) - Lentiviral human CHD8 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
NLGN4Y (KIAA0951, Neuroligin-4, Y-linked) (MaxLight 405) discontinued
130408-ML405 100 µL

NLGN4Y (KIAA0951, Neuroligin-4, Y-linked) (MaxLight 405) discontinued

Sign In for Pricing
View Details
trans-4,4'-Azodiphenol
TRC-A950000-2.5G 2.5 g

trans-4,4'-Azodiphenol

Sign In for Pricing
View Details
Gem-associated protein 7 (GEMIN7) Bovine ELISA Kit
D6661 96 Tests

Gem-associated protein 7 (GEMIN7) Bovine ELISA Kit

Sign In for Pricing
View Details
Omt2a Protein Vector (Mouse) (pPB-C-His)
PV212382 500 ng

Omt2a Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details