Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-7, Human (HEK293, His, solution)

Kallikrein-7 Protein (KLK7), a member of the tissue kallikrein family, is a first protease target of vaspin inhibited by classical serpin mechanism with high specificity in vitro. KLK7 cleaves human insulin in the A- and B-chain. KLK7 a serine protease with chymotrypsin-like activity which was involved in the regulated desquamation of terminally differentiated keratinocytes. KLK7 mediates the disruption of corneodesmosomes, the cell–cell adhesion junctions of corneocyites, by hydrolyzing the two mayor cadherins (corneodesmosin and desmocollin 1) in the extracellular region of these junctions. KLK7 overexpression and/or increased activity result in over-desquamation[1][2][3]. Kallikrein-7 Protein, Human (HEK293, His, solution) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-7 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-7-protein-human-hek-293-his.html

Purity

98.0

Smiles

EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKH

Molecular Formula

5650 (Gene_ID) AAH32005 (E23-H252) (Accession)

Molecular Weight

Approximately 28-32 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptpn2 Mouse shRNA Plasmid (Locus ID 19255)
TR512923 1 Kit

Ptpn2 Mouse shRNA Plasmid (Locus ID 19255)

Sign In for Pricing
View Details
Recombinant Mouse CALR/ Calreticulin Protein, His, Yeast-200ug
QP5750-ye-200ug 200ug

Recombinant Mouse CALR/ Calreticulin Protein, His, Yeast-200ug

Sign In for Pricing
View Details
ATP5F1A Antibody, Biotin conjugated
A13508-100UG 100 µg

ATP5F1A Antibody, Biotin conjugated

Sign In for Pricing
View Details
TRNAQ9 Protein Vector (Human) (pPM-C-HA)
PV139996 500 ng

TRNAQ9 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
DCSTAMP Polyclonal Antibody
MBS9134629-01 0.02 mL

DCSTAMP Polyclonal Antibody

Sign In for Pricing
View Details
DCSTAMP Polyclonal Antibody
MBS9134629-02 0.1 mL

DCSTAMP Polyclonal Antibody

Sign In for Pricing
View Details