Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-7, Human (HEK293, His, solution)

Kallikrein-7 Protein (KLK7), a member of the tissue kallikrein family, is a first protease target of vaspin inhibited by classical serpin mechanism with high specificity in vitro. KLK7 cleaves human insulin in the A- and B-chain. KLK7 a serine protease with chymotrypsin-like activity which was involved in the regulated desquamation of terminally differentiated keratinocytes. KLK7 mediates the disruption of corneodesmosomes, the cell–cell adhesion junctions of corneocyites, by hydrolyzing the two mayor cadherins (corneodesmosin and desmocollin 1) in the extracellular region of these junctions. KLK7 overexpression and/or increased activity result in over-desquamation[1][2][3]. Kallikrein-7 Protein, Human (HEK293, His, solution) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-7 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-7-protein-human-hek-293-his.html

Purity

98.0

Smiles

EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKH

Molecular Formula

5650 (Gene_ID) AAH32005 (E23-H252) (Accession)

Molecular Weight

Approximately 28-32 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nexn sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3853307 1.0 µg DNA

Nexn sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Eef1g Rat siRNA Oligo Duplex (Locus ID 293725)
SR505304 1 Kit

Eef1g Rat siRNA Oligo Duplex (Locus ID 293725)

Sign In for Pricing
View Details
RPL7AP23 3'UTR GFP Stable Cell Line
TU070516 1.0 mL

RPL7AP23 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-CEBP Alpha Rabbit pAb
GB11538-100 100 μL

Anti-CEBP Alpha Rabbit pAb

Sign In for Pricing
View Details
Lentiviral human LCA5 shRNA (UAS) - Lentiviral human LCA5 shRNA (UAS, iRFP) plasmid
GTR15077428 1 Vial

Lentiviral human LCA5 shRNA (UAS) - Lentiviral human LCA5 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Phospho-delta 1 Catenin (Tyr280) Recombinant Rabbit mAb
BS43314-01 50 µL

Phospho-delta 1 Catenin (Tyr280) Recombinant Rabbit mAb

Sign In for Pricing
View Details