Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Prorelaxin (RLN)

Product Specifications

Abbreviation

Recombinant Dog RLN protein

Gene Name

RLN

UniProt

Q9TRM8

Expression Region

26-177aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRERRQISEPLAEVVPSSIINDPEILSLMLQSIPGMPQELRIATRSGKEKLLRELHFVLEDSNLNLEEMKKTFLNTQFEAEDKSLSKLDKHPRKKRDNYIKMSDKCCNVGCTRRELASRC

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.1 kDa

References & Citations

"Canine preprorelaxin: nucleic acid sequence and localization within the canine placenta." Klonisch T., Hombach-Klonisch S., Froehlich C., Kauffold J., Steger K., Steinetz B.G., Fischer B. Biol. Reprod. 60:551-557 (1999) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-1 beta/IL-1F2 Antibody (43N3D8) [Alexa Fluor 350]
NBP2-27345AF350 0.1 mL

Mouse Monoclonal IL-1 beta/IL-1F2 Antibody (43N3D8) [Alexa Fluor 350]

Sign In for Pricing
View Details
Human PTP1B Affinity Purified Polyclonal Ab
AF1366 100 µg

Human PTP1B Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
TOP3B (Topoisomerase (DNA) III beta, FLJ39376) (APC)
252888-APC 100 µL

TOP3B (Topoisomerase (DNA) III beta, FLJ39376) (APC)

Sign In for Pricing
View Details
TBX19 Protein Vector (Rat) (pPM-C-HA)
PV310028 500 ng

TBX19 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Occludin Antibody FITC Conjugated
MBS9460682-01 0.1 mL

Occludin Antibody FITC Conjugated

Sign In for Pricing
View Details
Occludin Antibody FITC Conjugated
MBS9460682-02 5x 0.1 mL

Occludin Antibody FITC Conjugated

Sign In for Pricing
View Details