Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enterotoxin type C-2, S. aureus

Enterotoxin type C-2 (SEC2) activates the host immune system by binding the unprocessed molecule to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction forms a ternary complex that activates a large number of T lymphocytes and triggers the widespread release of proinflammatory cytokines. Enterotoxin type C-2 Protein, S. aureus is the recombinant Staphylococcus aureus-derived Enterotoxin type C-2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Enterotoxin type C-2 Protein, S. aureus, Staphylococcus aureus, E. coli

UNSPSC

12352202

Hazard Statement

H302+H332

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/enterotoxin-type-c-2-protein-s-aureus.html

Smiles

ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG

Molecular Formula

/ (Gene_ID) P34071 (E28-G266) (Accession)

Molecular Weight

Approximately 27.6 kDa

Precautions

H302+H332

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM184C Antibody
OAPB01079-100UG 0.1 mg

TMEM184C Antibody

Sign In for Pricing
View Details
CDK9 autophagic degrader 1
T204672-01 10 mg

CDK9 autophagic degrader 1

Sign In for Pricing
View Details
CDK9 autophagic degrader 1
T204672-02 50 mg

CDK9 autophagic degrader 1

Sign In for Pricing
View Details
C19orf51 (Dynein Assembly Factor 3, axonemal, DNAAF3, C19orf51) (MaxLight 490)
MBS6454628-01 0.1 mL

C19orf51 (Dynein Assembly Factor 3, axonemal, DNAAF3, C19orf51) (MaxLight 490)

Sign In for Pricing
View Details
C19orf51 (Dynein Assembly Factor 3, axonemal, DNAAF3, C19orf51) (MaxLight 490)
MBS6454628-02 5x 0.1 mL

C19orf51 (Dynein Assembly Factor 3, axonemal, DNAAF3, C19orf51) (MaxLight 490)

Sign In for Pricing
View Details
Human GGCX (NM_001142269) AAV Particle
RC226869A1V 250 µL

Human GGCX (NM_001142269) AAV Particle

Sign In for Pricing
View Details