Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-9, Human (CHO)

IL-9 Protein, Human (CHO) is a CHO cell derived immunoregulatory cytokine produced by IL-2 activated Th2 lymphocytes.

Product Specifications

Product Name Alternative

IL-9 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/il-9-protein-human-cho.html

Purity

95.00

Smiles

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Molecular Formula

3578 (Gene_ID) P15248 (Q19-I144) (Accession)

Molecular Weight

Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Miyazawa K, et al. Recombinant human interleukin-9 induces protein tyrosine phosphorylation and synergizes with steel factor to stimulate proliferation of the human factor-dependent cell line, M07e. Blood. 1992 Oct 1;80 (7) :1685-92.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Geminin antibody
10R-1034 100 µL

Geminin antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Spleen
CS627750 5x 5 µm

Frozen Tissue Sections, Spleen

Sign In for Pricing
View Details
Scamp2 (NM_022813) Mouse Recombinant Protein
TP504832 20 µg

Scamp2 (NM_022813) Mouse Recombinant Protein

Sign In for Pricing
View Details
KDM5A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-16947R-BF350 100 µL

KDM5A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Rat Solute Carrier Family 22 Member 2 (SLC22A2) ELISA Kit
abx544161 96 Tests

Rat Solute Carrier Family 22 Member 2 (SLC22A2) ELISA Kit

Sign In for Pricing
View Details
ICAM-1 (h) -PR
sc-29354-PR 10 µM - 20 µL

ICAM-1 (h) -PR

Sign In for Pricing
View Details