Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-9, Human (CHO)

IL-9 Protein, Human (CHO) is a CHO cell derived immunoregulatory cytokine produced by IL-2 activated Th2 lymphocytes.

Product Specifications

Product Name Alternative

IL-9 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/il-9-protein-human-cho.html

Purity

95.00

Smiles

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Molecular Formula

3578 (Gene_ID) P15248 (Q19-I144) (Accession)

Molecular Weight

Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Miyazawa K, et al. Recombinant human interleukin-9 induces protein tyrosine phosphorylation and synergizes with steel factor to stimulate proliferation of the human factor-dependent cell line, M07e. Blood. 1992 Oct 1;80 (7) :1685-92.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFR2 Mouse
OM297120-01 20 µg

TNFR2 Mouse

Sign In for Pricing
View Details
TNFR2 Mouse
OM297120-02 5 µg

TNFR2 Mouse

Sign In for Pricing
View Details
TNFR2 Mouse
OM297120-03 1 mg

TNFR2 Mouse

Sign In for Pricing
View Details
EEF1D Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-13055R-APC-Cy5.5 100 µL

EEF1D Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
TNFRSF25 CRISPRa sgRNA lentivector (set of three targets)(Rat)
47215126 3x 1.0µg DNA

TNFRSF25 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Kcnh5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7069007 1.0 µg DNA

Kcnh5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details