IL-9, Human (CHO)
IL-9 Protein, Human (CHO) is a CHO cell derived immunoregulatory cytokine produced by IL-2 activated Th2 lymphocytes.
Product Specifications
Product Name Alternative
IL-9 Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Applications
COVID-19-immunoregulation
Assay Protocol
https://www.medchemexpress.com/cytokines/il-9-protein-human-cho.html
Purity
95.00
Smiles
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Molecular Formula
3578 (Gene_ID) P15248 (Q19-I144) (Accession)
Molecular Weight
Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Miyazawa K, et al. Recombinant human interleukin-9 induces protein tyrosine phosphorylation and synergizes with steel factor to stimulate proliferation of the human factor-dependent cell line, M07e. Blood. 1992 Oct 1;80 (7) :1685-92.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1293073-01 0.02 mg (E-Coli)
Recombinant Erythrobacter litoralis Ribonuclease H (rnhA)
Sign In for Pricing
View Details MBS1293073-02 0.1 mg (E-Coli)
Recombinant Erythrobacter litoralis Ribonuclease H (rnhA)
Sign In for Pricing
View Details MBS1293073-03 0.02 mg (Yeast)
Recombinant Erythrobacter litoralis Ribonuclease H (rnhA)
Sign In for Pricing
View Details MBS1293073-04 0.1 mg (Yeast)
Recombinant Erythrobacter litoralis Ribonuclease H (rnhA)
Sign In for Pricing
View Details MBS1293073-05 0.02 mg (Baculovirus)
Recombinant Erythrobacter litoralis Ribonuclease H (rnhA)
Sign In for Pricing
View Details MBS1293073-06 0.02 mg (Mammalian-Cell)
Recombinant Erythrobacter litoralis Ribonuclease H (rnhA)
Sign In for Pricing
View Details