GDF-2/BMP-9, Human (P. pastoris, His)
The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html
Purity
95.00
Smiles
HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
Molecular Formula
2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)
Molecular Weight
Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
RPS6KB1 (Ser404) (Ribosomal Protein S6 Kinase beta-1, S6K-beta-1, S6K1, 70kD Ribosomal Protein S6 Kinase 1, P70S6K1, p70-S6K 1, p70 Ribosomal S6 Kinase alpha, p70 S6 Kinase alpha, p70 S6K-alpha, p70 S6KA, p70-S6K, Ribosomal Protein S6 Kinase I, Serine/threonine-protein Kinase 14A, STK14A) (PE) discontinued
CMAS (N-acylneuraminate Cytidylyltransferase, CMP-N-acetylneuraminic Acid Synthase, CMP-NeuNAc Synthase) (AP) discontinued
Mouse Monoclonal CD72 Antibody (BU40) [mFluor Violet 610 SE]
Human secretory leukocyte protease inhibitor (SLPI) Elisa Kit