Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UFS 3'UTR GFP Stable Cell Line
TU077771 1.0 mL

UFS 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
LAPTM5 Protein Vector (Rat) (pPB-N-His)
PV277095 500 ng

LAPTM5 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Mmu-miR-6935-3p inhibitor
HY-RI03593-01 5 nmol

Mmu-miR-6935-3p inhibitor

Sign In for Pricing
View Details
Mmu-miR-6935-3p inhibitor
HY-RI03593-02 20 nmol

Mmu-miR-6935-3p inhibitor

Sign In for Pricing
View Details
Bovine Receptor expression-enhancing protein 6, REEP6 ELISA KIT
ELI-18225b 96 Tests

Bovine Receptor expression-enhancing protein 6, REEP6 ELISA KIT

Sign In for Pricing
View Details
NAPSA Protein Vector (Human) (pPB-C-His)
PV027581 500 ng

NAPSA Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details