Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella flexneri Inner membrane protein yaaH (yaaH), partial
MBS7062416 Inquire

Recombinant Shigella flexneri Inner membrane protein yaaH (yaaH), partial

Sign In for Pricing
View Details
Donkey Disrupted In Renal Carcinoma Protein 2 (DIRC2) ELISA Kit
MBS9353598 Inquire

Donkey Disrupted In Renal Carcinoma Protein 2 (DIRC2) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Mrpl20 shRNA (UAS) - Lentiviral mouse Mrpl20 shRNA (UAS, GFP) (100)
GTR15189573 1 Vial

Lentiviral mouse Mrpl20 shRNA (UAS) - Lentiviral mouse Mrpl20 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
HHLA2 Antibody, HRP conjugated
A71400-50UG 50 µg

HHLA2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) POF14 Polyclonal Antibody
MBS7187932 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) POF14 Polyclonal Antibody

Sign In for Pricing
View Details
STX10 Antibody, Biotin conjugated
A35900-100UG 100 µg

STX10 Antibody, Biotin conjugated

Sign In for Pricing
View Details