Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Toluol für die HPLC
LC-2731.2 2.5 L

Toluol für die HPLC

Sign In for Pricing
View Details
2 mL Empty Spin Columns, outer tubes, capped inner tubes, UHMW-PE frits and fixing rings
007400 1 Package

2 mL Empty Spin Columns, outer tubes, capped inner tubes, UHMW-PE frits and fixing rings

Sign In for Pricing
View Details
Albumin, Human Serum (HSA) (AP) discontinued
A1275-07-AP 100 µL

Albumin, Human Serum (HSA) (AP) discontinued

Sign In for Pricing
View Details
GAGE12J sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0833705 3x 1.0 µg

GAGE12J sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rat IFNG shRNA Plasmid
abx985243-01 150 µg

Rat IFNG shRNA Plasmid

Sign In for Pricing
View Details
Rat IFNG shRNA Plasmid
abx985243-02 300 µg

Rat IFNG shRNA Plasmid

Sign In for Pricing
View Details