Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ube2f Mouse Pre-designed siRNA Set A
HY-RS20507 1 Set

Ube2f Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
PCT (Procalcitonin) Porcine ELISA Kit
F7190 96 Tests

PCT (Procalcitonin) Porcine ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Setmar shRNA (UAS) - Lentiviral mouse Setmar shRNA (UAS, iRFP) (100)
GTR15112227 1 Vial

Lentiviral mouse Setmar shRNA (UAS) - Lentiviral mouse Setmar shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Phospho-MAPKAPK5 (Thr182) Polyclonal Antibody, APC Conjugated
bs-5504R-APC 100 µL

Phospho-MAPKAPK5 (Thr182) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
SGTB siRNA (Human)
MBS8228252-01 15 nmol

SGTB siRNA (Human)

Sign In for Pricing
View Details
SGTB siRNA (Human)
MBS8228252-02 30 nmol

SGTB siRNA (Human)

Sign In for Pricing
View Details