Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSCR8 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV706238 1.0 µg DNA

DSCR8 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Compound NP-013735
MBS5794789 Inquire

Compound NP-013735

Sign In for Pricing
View Details
Mouse Rnf8 Pre-designed siRNA Set B
SI112141B 1 Each

Mouse Rnf8 Pre-designed siRNA Set B

Sign In for Pricing
View Details
C1orf104 sgRNA CRISPR Lentivector (Human) (Target 2)
K0210303 1.0 µg DNA

C1orf104 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lentiviral mouse Gnpnat1 shRNA (UAS) - Lentiviral mouse Gnpnat1 shRNA (UAS, GFP) (100)
GTR15248445 1 Vial

Lentiviral mouse Gnpnat1 shRNA (UAS) - Lentiviral mouse Gnpnat1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Olr399 3'UTR Luciferase Stable Cell Line
TU215171 1.0 mL

Olr399 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details