Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSB603
532482 5.0mg

PSB603

Sign In for Pricing
View Details
Mgst3 Mouse Gene Knockout Kit (CRISPR)
KN510073 1 Kit

Mgst3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mmu-miR-466e-3p miRNA Mimic
CMM0517-01 5 nmol

Mmu-miR-466e-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-466e-3p miRNA Mimic
CMM0517-02 10 nmol

Mmu-miR-466e-3p miRNA Mimic

Sign In for Pricing
View Details
Recombinant Human EIF2D Protein, N-His
E55P4535 50 µg

Recombinant Human EIF2D Protein, N-His

Sign In for Pricing
View Details
GST-tag Antibody
MBS8584228-01 0.1 mL

GST-tag Antibody

Sign In for Pricing
View Details