Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zuclopenthixol-d4 (-) -10-Camphorsulfonic Acid Salt
023010 1 mg

Zuclopenthixol-d4 (-) -10-Camphorsulfonic Acid Salt

Sign In for Pricing
View Details
MERTK (NM_006343) Human Tagged Lenti ORF Clone
RC215289L4 10 µg

MERTK (NM_006343) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal NBR1 Antibody
NBP2-58516-25ul 25 µL

Rabbit Polyclonal NBR1 Antibody

Sign In for Pricing
View Details
Hnrnpa2b1 Mouse qPCR Primer Pair (NM_016806)
MP206059 200 Reactions

Hnrnpa2b1 Mouse qPCR Primer Pair (NM_016806)

Sign In for Pricing
View Details
LOC340602 antibody
70R-4282 50 ug

LOC340602 antibody

Sign In for Pricing
View Details
Rat Monoclonal SOST/Sclerostin Antibody (RM0129-4D77) [Alexa Fluor 405]
NBP1-22506AF405 0.1 mL

Rat Monoclonal SOST/Sclerostin Antibody (RM0129-4D77) [Alexa Fluor 405]

Sign In for Pricing
View Details