Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thioredoxin Reductase 1 antibody
MBS832326 Inquire

Thioredoxin Reductase 1 antibody

Sign In for Pricing
View Details
DHRS1 (NM_001136050) Human Mass Spec Standard
PH327656 10 µg

DHRS1 (NM_001136050) Human Mass Spec Standard

Sign In for Pricing
View Details
Rabbit Polyclonal EID1 Antibody [Alexa Fluor 350]
NBP2-97540AF350 0.1 mL

Rabbit Polyclonal EID1 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Manba 3'UTR Luciferase Stable Cell Line
TU112843 1.0 mL

Manba 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
(-) -Menthyl Chloroformate
284881-01 5 g

(-) -Menthyl Chloroformate

Sign In for Pricing
View Details
(-) -Menthyl Chloroformate
284881-02 10 g

(-) -Menthyl Chloroformate

Sign In for Pricing
View Details