Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor hsa-miR-4736 AAV miRNA Vector
Amh3171500 500 ng

Inhibitor hsa-miR-4736 AAV miRNA Vector

Sign In for Pricing
View Details
ARVD3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0129907 1.0 µg DNA

ARVD3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)
SDPA286Mu21-01 10 µg

OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)

Sign In for Pricing
View Details
OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)
SDPA286Mu21-02 50 µg

OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)

Sign In for Pricing
View Details
OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)
SDPA286Mu21-03 200 µg

OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)

Sign In for Pricing
View Details
OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)
SDPA286Mu21-04 1 mg

OVA Conjugated Procollagen II C-Terminal Propeptide (PIICP)

Sign In for Pricing
View Details