Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal 14-3-3 Antibody [Alexa Fluor 350]
NBP2-97724AF350 0.1 mL

Rabbit Polyclonal 14-3-3 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Gemcitabine HCl, DNA polymerase inhibitor
TBI2140-50MG 50 mg

Gemcitabine HCl, DNA polymerase inhibitor

Sign In for Pricing
View Details
Rat TNFb (Tumor Necrosis Factor Beta) ELISA Kit
ER21353 96 Tests

Rat TNFb (Tumor Necrosis Factor Beta) ELISA Kit

Sign In for Pricing
View Details
Gm3238 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3330706 1.0 µg DNA

Gm3238 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
SLC6A18 siRNA (Human)
MBS8206594-01 15 nmol

SLC6A18 siRNA (Human)

Sign In for Pricing
View Details
SLC6A18 siRNA (Human)
MBS8206594-02 30 nmol

SLC6A18 siRNA (Human)

Sign In for Pricing
View Details