GDF-2/BMP-9, Human (P. pastoris, His)
The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html
Purity
95.00
Smiles
HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
Molecular Formula
2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)
Molecular Weight
Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Retinol Binding Protein (Cellular Retinol-binding Protein I, CRBP1, CRBP2, RBP1, RBP2, RBP4, RBPC, Retinol binding Protein 1, Retinol binding Protein 1 Cellular, Retinol binding Protein 2 Cellular, Retinol binding Protein 4 plasma, RBP) (APC)
![Mouse Monoclonal Cadherin-16 Antibody (03) [Janelia Fluor 549]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
Mouse Monoclonal Cadherin-16 Antibody (03) [Janelia Fluor 549]
Biotin-Linked Polyclonal Antibody to Complement Factor B (CFB)
Biotin-Linked Polyclonal Antibody to Complement Factor B (CFB)
Biotin-Linked Polyclonal Antibody to Complement Factor B (CFB)