Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

5x Passive lysis buffer
PR300004 30 mL

5x Passive lysis buffer

Sign In for Pricing
View Details
DSIP (Delta-Sleep Inducing Peptide, DSIPI, TSC22D3, DIP, GILZ, TSC-22R, hDIP, TSC22 Domain Family Protein 3, Glucocorticoid-Induced Leucine Zipper, Delta Sleep Inducing Peptide, Immunoreactor)
362892 200 µL

DSIP (Delta-Sleep Inducing Peptide, DSIPI, TSC22D3, DIP, GILZ, TSC-22R, hDIP, TSC22 Domain Family Protein 3, Glucocorticoid-Induced Leucine Zipper, Delta Sleep Inducing Peptide, Immunoreactor)

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-1187 Vector
mm30044 500 ng

LentimiRa-Off-mmu-miR-1187 Vector

Sign In for Pricing
View Details
GPX1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV727034 1.0 µg DNA

GPX1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Lentiviral human FAM171A1 shRNA (UAS) - Lentiviral human FAM171A1 shRNA (UAS, RFP) (25)
GTR15133703 1 Vial

Lentiviral human FAM171A1 shRNA (UAS) - Lentiviral human FAM171A1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
4-Phenyl-1,2,3-triazoline-3,5-dione
286797-01 500 mg

4-Phenyl-1,2,3-triazoline-3,5-dione

Sign In for Pricing
View Details