Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPY2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2543504 1.0 µg DNA

TSPY2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal Prohibitin Antibody (PHB/3226) [CoraFluor 1]
NBP3-08754CL1 0.1 mL

Mouse Monoclonal Prohibitin Antibody (PHB/3226) [CoraFluor 1]

Sign In for Pricing
View Details
Probable polyprenol Reductase (SRD5A3) Rat ELISA Kit
G1362 96 Tests

Probable polyprenol Reductase (SRD5A3) Rat ELISA Kit

Sign In for Pricing
View Details
rno-miR-935 miRNA Mimic
MBS8302904-01 5 nmol

rno-miR-935 miRNA Mimic

Sign In for Pricing
View Details
rno-miR-935 miRNA Mimic
MBS8302904-02 10 nmol

rno-miR-935 miRNA Mimic

Sign In for Pricing
View Details
rno-miR-935 miRNA Mimic
MBS8302904-03 5x 10 nmol

rno-miR-935 miRNA Mimic

Sign In for Pricing
View Details