Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smc5 ORF Vector (Mouse) (pORF)
ORF057969 1.0 µg DNA

Smc5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti-Eph receptor A7  (1G11)
YF-MA12868 200 ul

Anti-Eph receptor A7 (1G11)

Sign In for Pricing
View Details
Rabbit Polyclonal DCAMKL2 Antibody [Alexa Fluor 488]
NBP1-77128AF488 0.1 mL

Rabbit Polyclonal DCAMKL2 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
UGT2B29P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2586105 3x 1.0 µg

UGT2B29P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Lactamase Beta (LACTb)
SIPJ802Hu01-01 10 µg

Recombinant Lactamase Beta (LACTb)

Sign In for Pricing
View Details
Recombinant Lactamase Beta (LACTb)
SIPJ802Hu01-02 50 µg

Recombinant Lactamase Beta (LACTb)

Sign In for Pricing
View Details