Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFNA1 Antibody
A74738-50UL 50 μL

EFNA1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal West Nile Virus MP Antibody [mFluor Violet 610 SE]
NBP2-41052MFV610 0.1 mL

Rabbit Polyclonal West Nile Virus MP Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike Protein (S2 ECD, His tag)
BSV-COV-PR-06 100 ug

SARS-CoV-2 (2019-nCoV) Spike Protein (S2 ECD, His tag)

Sign In for Pricing
View Details
Ighmbp2 ORF Vector (Rat) (pORF)
ORF068557 1.0 µg DNA

Ighmbp2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Stx3 Mouse siRNA Oligo Duplex (Locus ID 20908)
SR408251 1 Kit

Stx3 Mouse siRNA Oligo Duplex (Locus ID 20908)

Sign In for Pricing
View Details
SUMO2/SUMO3 Rabbit Polyclonal Antibody
AF8082 50 µL

SUMO2/SUMO3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details