Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-2/BMP-9, Human (P. pastoris, His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. GDF-2/BMP-9 Protein, Human (P. pastoris, His) is the recombinant human-derived GDF-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GDF-2/BMP-9 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-2-protein-human-p-pastoris.html

Purity

95.00

Smiles

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (H300-R429) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti Rat IgG1 IgG2a IgG2b IgG2c (Fc specific), conjugated with Horseradish peroxidase
MBS571516-01 1 mL

Goat anti Rat IgG1 IgG2a IgG2b IgG2c (Fc specific), conjugated with Horseradish peroxidase

Sign In for Pricing
View Details
Goat anti Rat IgG1 IgG2a IgG2b IgG2c (Fc specific), conjugated with Horseradish peroxidase
MBS571516-02 5x 1 mL

Goat anti Rat IgG1 IgG2a IgG2b IgG2c (Fc specific), conjugated with Horseradish peroxidase

Sign In for Pricing
View Details
Annexin A3 Antibody
ASA-B0097 1 Each

Annexin A3 Antibody

Sign In for Pricing
View Details
Anti-Ferritin Light Chain Rabbit pAb
GB115537 100 μL

Anti-Ferritin Light Chain Rabbit pAb

Sign In for Pricing
View Details
TGF beta 3 humant rec., 2 μg
BS.WF.19.0002 2 μg

TGF beta 3 humant rec., 2 μg

Sign In for Pricing
View Details
Lentiviral human SNX27 shRNA (UAS) - Lentiviral human SNX27 shRNA (UAS) plasmid
GTR15161299 1 Vial

Lentiviral human SNX27 shRNA (UAS) - Lentiviral human SNX27 shRNA (UAS) plasmid

Sign In for Pricing
View Details