Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBP1, Human (His)

HBP1 is a transcriptional repressor that regulates target genes by binding specifically to promoter regions, specifically favoring the sequence 5'-TTCATTCATTCA-3'.Its key role in the cell cycle and Wnt pathway involves promoting enhanced binding to the histone H1.0 promoter through the RB1 interaction.HBP1 Protein, Human (His) is the recombinant human-derived HBP1 protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HBP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hbp1-protein-human-gst.html

Purity

97.00

Smiles

PSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINF

Molecular Formula

26959 (Gene_ID) O60381 (P208-F345) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cytochrome b reductase 1 (CYBRD1) activation kit by CRISPRa
GA112718 1 Kit

Human Cytochrome b reductase 1 (CYBRD1) activation kit by CRISPRa

Sign In for Pricing
View Details
PKC epsilon (PRKCE) Human Gene Knockout Kit (CRISPR)
KN417702 1 Kit

PKC epsilon (PRKCE) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL17 (IL17A) (NM_002190) Human Recombinant Protein
TP318057 20 µg

IL17 (IL17A) (NM_002190) Human Recombinant Protein

Sign In for Pricing
View Details
P55;50 EBV-Early Antigen (1108-1), Biotin conjugate, 0.1mg/mL
BNCB0103-100 1x 100 µL

P55;50 EBV-Early Antigen (1108-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spiramycin I-d3
TRC-S682302-1MG 1 mg

Spiramycin I-d3

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS806609 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details