Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBP1, Human (His)

HBP1 is a transcriptional repressor that regulates target genes by binding specifically to promoter regions, specifically favoring the sequence 5'-TTCATTCATTCA-3'.Its key role in the cell cycle and Wnt pathway involves promoting enhanced binding to the histone H1.0 promoter through the RB1 interaction.HBP1 Protein, Human (His) is the recombinant human-derived HBP1 protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HBP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hbp1-protein-human-gst.html

Purity

97.00

Smiles

PSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINF

Molecular Formula

26959 (Gene_ID) O60381 (P208-F345) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBA52 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C1]
TA805018BM 100 µL

UBA52 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C1]

Sign In for Pricing
View Details
DOG-1 (DG1/447 + DOG1.1), Biotin conjugate, 0.1mg/mL
BNCB0726-100 1x 100 µL

DOG-1 (DG1/447 + DOG1.1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR5W2 Antibody
8G657-AAT 50 µg

OR5W2 Antibody

Sign In for Pricing
View Details
ERK1 / ERK2 pThr187/pTyr204 Rabbit Polyclonal Antibody
AP02499PU-N 100 µL

ERK1 / ERK2 pThr187/pTyr204 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Delta 6(7)-Norelgestromin
TRC-D195175-5MG 5 mg

Delta 6(7)-Norelgestromin

Sign In for Pricing
View Details
Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H3]
TA506165AM 100 µL

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H3]

Sign In for Pricing
View Details