Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBP1, Human (His)

HBP1 is a transcriptional repressor that regulates target genes by binding specifically to promoter regions, specifically favoring the sequence 5'-TTCATTCATTCA-3'.Its key role in the cell cycle and Wnt pathway involves promoting enhanced binding to the histone H1.0 promoter through the RB1 interaction.HBP1 Protein, Human (His) is the recombinant human-derived HBP1 protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HBP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hbp1-protein-human-gst.html

Purity

97.00

Smiles

PSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINF

Molecular Formula

26959 (Gene_ID) O60381 (P208-F345) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiO perchlorate [3,3-Dioctadecyloxacarbocyanine perchlorate] *CAS#: 34215-57-1*
22066-AAT 25 mg

DiO perchlorate [3,3-Dioctadecyloxacarbocyanine perchlorate] *CAS#: 34215-57-1*

Sign In for Pricing
View Details
LOC101930123 Rabbit Polyclonal Antibody
AP06095PU-N 100 µg

LOC101930123 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adss Mouse Gene Knockout Kit (CRISPR)
KN500940 1 Kit

Adss Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF594 conjugate, 0.1mg/mL
BNC942043-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lisuride Maleate
TRC-L469078-1MG 1 mg

Lisuride Maleate

Sign In for Pricing
View Details
Reg3a Mouse Gene Knockout Kit (CRISPR)
KN514650 1 Kit

Reg3a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details