HBP1, Human (His)
HBP1 is a transcriptional repressor that regulates target genes by binding specifically to promoter regions, specifically favoring the sequence 5'-TTCATTCATTCA-3'.Its key role in the cell cycle and Wnt pathway involves promoting enhanced binding to the histone H1.0 promoter through the RB1 interaction.HBP1 Protein, Human (His) is the recombinant human-derived HBP1 protein, expressed by E.coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
HBP1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hbp1-protein-human-gst.html
Purity
97.00
Smiles
PSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINF
Molecular Formula
26959 (Gene_ID) O60381 (P208-F345) (Accession)
Molecular Weight
Approximately 17 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CYP26A1, ID (Cytochrome P450, Family 26, Subfamily A, Polypeptide 1, Cytochrome P450, 26A1, Retinoic Acid-metabolizing Cytochrome, Cytochrome P450 Retinoic Acid-Inactivating 1, Cytochrome P450RAI, hP450RAI, Retinoic Acid 4-hydroxylase, CYP26, P450RAI1) (H
CYP26A1, ID (Cytochrome P450, Family 26, Subfamily A, Polypeptide 1, Cytochrome P450, 26A1, Retinoic Acid-metabolizing Cytochrome, Cytochrome P450 Retinoic Acid-Inactivating 1, Cytochrome P450RAI, hP450RAI, Retinoic Acid 4-hydroxylase, CYP26, P450RAI1) (H
Human Histidine Rich Calcium Binding Protein (HRC) CLIA Kit