Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD44 antigen (CD44) , partial

Product Specifications

CAS Number

9000-83-3

Gene Name

CD44

UniProt

P16070

Expression Region

224-603aa

Organism

Homo sapiens

Target Sequence

LMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLS

Tag

C-terminal hFc-tagged

Source

Mammalian cell

Field of Research

Cancer

Assay Type

Developed Protein

Relevance

Cell-surface receptor that plays a role in cell-cell interactions, cell adhesion and migration, helping them to sense and respond to changes in the tissue microenvironment. Participates thereby in a wide variety of cellular functions including the activation, recirculation and homing of T-lymphocytes, hematopoiesis, inflammation and response to bacterial infection. Engages, through its ectodomain, extracellular matrix components such as hyaluronan/HA, collagen, growth factors, cytokines or proteases and serves as a platform for signal transduction by assembling, via its cytoplasmic domain, protein complexes containing receptor kinases and membrane proteases. Such effectors include PKN2, the RhoGTPases RAC1 and RHOA, Rho-kinases and phospholipase C that coordinate signaling pathways promoting calcium mobilization and actin-mediated cytoskeleton reorganization essential for cell migration and adhesion.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

71.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIBU 1361 Dihydrochloride
TRC-B377008-2.5MG 2.5 mg

BIBU 1361 Dihydrochloride

Sign In for Pricing
View Details
CEBP Alpha (CEBPA) Rabbit Polyclonal Antibody
AP06373PU-N 100 µg

CEBP Alpha (CEBPA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CALD1 Antibody
RC-6961-01 50 μL

Recombinant CALD1 Antibody

Sign In for Pricing
View Details
Recombinant CALD1 Antibody
RC-6961-02 100 µL

Recombinant CALD1 Antibody

Sign In for Pricing
View Details
Recombinant CALD1 Antibody
RC-6961-03 1 mL

Recombinant CALD1 Antibody

Sign In for Pricing
View Details
Ccdc124 Mouse Gene Knockout Kit (CRISPR)
KN502647 1 Kit

Ccdc124 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details