Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog B-lymphocyte antigen CD20 (MS4A1), partial

Product Specifications

Product Name Alternative

(Membrane-spanning 4-domains subfamily A member 1) (CD antigen CD20)

Abbreviation

Recombinant Dog MS4A1 protein, partial

Gene Name

MS4A1

UniProt

Q3C2E2

Expression Region

210-297aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

GIVENEWKKLCSKPKSDVVVLLAAEEKKEQPIETTEEMVELTEIASQPKKEEDIEIIPVQEEEGELEINFAEPPQEQESSPIENDSIP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.4 kDa

References & Citations

B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EPHB2 Pre-designed siRNA Set A
SI005041A 1 Each

Human EPHB2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen
NBP2-55786PEP 100 µL

VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen

Sign In for Pricing
View Details
Calcium chloride, anhydrous, 95%, granular, 1 mm
GE5772-250g 250 g

Calcium chloride, anhydrous, 95%, granular, 1 mm

Sign In for Pricing
View Details
TIAM1 (NM_003253) Human Tagged Lenti ORF Clone
RC220233L4 10 µg

TIAM1 (NM_003253) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
StIP1 shRNA Plasmid (h)
sc-44436-SH 20 µg

StIP1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Stag1 3'UTR GFP Stable Cell Line
TU169796 1.0 mL

Stag1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details