Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Integrin alpha L/CD11a Antibody (MEM-25) [Alexa Fluor 405]
NB500-328AF405 0.1 mL

Mouse Monoclonal Integrin alpha L/CD11a Antibody (MEM-25) [Alexa Fluor 405]

Sign In for Pricing
View Details
Mouse Fbxo9 activation kit by CRISPRa
GA208853 1 Kit

Mouse Fbxo9 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Netrin-G2,NTNG2 ELISA KIT
ELI-44497h 96 Tests

Human Netrin-G2,NTNG2 ELISA KIT

Sign In for Pricing
View Details
YIPF3 Protein Vector (Rat) (pPM-C-HA)
50613026 500 ng

YIPF3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ZNF674 Human Gene Knockout Kit (CRISPR)
KN413577 1 Kit

ZNF674 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTEN Polyclonal Antibody
RD90056A-01 60 μL

PTEN Polyclonal Antibody

Sign In for Pricing
View Details