Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MEX3D Antibody
NBP3-04155-20ul 20 µL

Rabbit Polyclonal MEX3D Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ppp3cb shRNA (UAS) - Lentiviral mouse Ppp3cb shRNA (UAS, GFP) (100)
GTR15196173 1 Vial

Lentiviral mouse Ppp3cb shRNA (UAS) - Lentiviral mouse Ppp3cb shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Acetylcysteine Impurity 5
RM-A030305-01 10 mg

Acetylcysteine Impurity 5

Sign In for Pricing
View Details
Acetylcysteine Impurity 5
RM-A030305-02 25 mg

Acetylcysteine Impurity 5

Sign In for Pricing
View Details
Acetylcysteine Impurity 5
RM-A030305-03 50 mg

Acetylcysteine Impurity 5

Sign In for Pricing
View Details
Acetylcysteine Impurity 5
RM-A030305-04 100 mg

Acetylcysteine Impurity 5

Sign In for Pricing
View Details