Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfamethazine (SM2) ELISA Kit
EKF1091 96 Tests

Sulfamethazine (SM2) ELISA Kit

Sign In for Pricing
View Details
Trappc3 Mouse siRNA Oligo Duplex (Locus ID 27096)
SR404339 1 Kit

Trappc3 Mouse siRNA Oligo Duplex (Locus ID 27096)

Sign In for Pricing
View Details
Brucella abortus IgM ELISA kit
55R-IB79212 96 wells

Brucella abortus IgM ELISA kit

Sign In for Pricing
View Details
Sheep Progesterone receptor membrane component 2 ELISA Kit
MBS7281303-01 48 Well

Sheep Progesterone receptor membrane component 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Progesterone receptor membrane component 2 ELISA Kit
MBS7281303-02 96 Well

Sheep Progesterone receptor membrane component 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Progesterone receptor membrane component 2 ELISA Kit
MBS7281303-03 5x 96 Well

Sheep Progesterone receptor membrane component 2 ELISA Kit

Sign In for Pricing
View Details