Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGTRAP (ATRAP, Type-1 Angiotensin II Receptor-associated Protein, AT1 Receptor-associated Protein, MGC29646) (APC)
123079-APC 100 µL

AGTRAP (ATRAP, Type-1 Angiotensin II Receptor-associated Protein, AT1 Receptor-associated Protein, MGC29646) (APC)

Sign In for Pricing
View Details
Anti-Olfactory receptor 51H1 antibody
STJ94732 200 µl

Anti-Olfactory receptor 51H1 antibody

Sign In for Pricing
View Details
SEC13L1 (SEC13) (NM_001136232) Human Tagged ORF Clone
RC226933 10 µg

SEC13L1 (SEC13) (NM_001136232) Human Tagged ORF Clone

Sign In for Pricing
View Details
GMFG siRNA (Human)
MBS8218523-01 15 nmol

GMFG siRNA (Human)

Sign In for Pricing
View Details
GMFG siRNA (Human)
MBS8218523-02 30 nmol

GMFG siRNA (Human)

Sign In for Pricing
View Details
GMFG siRNA (Human)
MBS8218523-03 5x 30 nmol

GMFG siRNA (Human)

Sign In for Pricing
View Details