Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS525544 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Rabbit Polyclonal HORMAD1 Antibody
NBP2-54973-25ul 25 µL

Rabbit Polyclonal HORMAD1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal MSH6 Antibody (rMSH6/8106) [DyLight 550]
NBP3-20825R 0.1 mL

Mouse Monoclonal MSH6 Antibody (rMSH6/8106) [DyLight 550]

Sign In for Pricing
View Details
PRSS48 sgRNA CRISPR Lentivector (Human) (Target 1)
K2797302 1.0 µg DNA

PRSS48 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human RBED1 (ELMOD3) activation kit by CRISPRa
GA113407 1 Kit

Human RBED1 (ELMOD3) activation kit by CRISPRa

Sign In for Pricing
View Details
UTS2D Antibody (N-term) Blocking Peptide
MBS9222692-01 0.5 mg

UTS2D Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details