Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Betacellulin/BTC Antibody (RM0154-9H1) [Alexa Fluor 750]
NBP2-12053AF750 0.1 mL

Rat Monoclonal Betacellulin/BTC Antibody (RM0154-9H1) [Alexa Fluor 750]

Sign In for Pricing
View Details
Dusp21 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3865802 1.0 µg DNA

Dusp21 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Dengue Type 3 (MaxLight 405) discontinued, see D2810-06
D2800-15-ML405 100 µL

Dengue Type 3 (MaxLight 405) discontinued, see D2810-06

Sign In for Pricing
View Details
Rat GATA Binding Protein 4 ELISA Kit
MBS762910-01 48 Well

Rat GATA Binding Protein 4 ELISA Kit

Sign In for Pricing
View Details
Rat GATA Binding Protein 4 ELISA Kit
MBS762910-02 96 Well

Rat GATA Binding Protein 4 ELISA Kit

Sign In for Pricing
View Details
Rat GATA Binding Protein 4 ELISA Kit
MBS762910-03 5x 96 Well

Rat GATA Binding Protein 4 ELISA Kit

Sign In for Pricing
View Details