Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)
Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.
Product Specifications
Product Name Alternative
Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html
Purity
97.00
Smiles
GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
Molecular Formula
21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)
Molecular Weight
Approximately 27 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP1-60060 100 µL
Rabbit Polyclonal Pipecolic acid oxidase Antibody
Sign In for Pricing
View Details abx117521 5x 96 Tests
Interstitial Collagenase (MMP1) Antibody Pair
Sign In for Pricing
View Details 
040102-Biotin 200 µL
PKM2, NT (E131) (PKM, OIP3, PK2, PK3, PKM2, Pyruvate kinase isozymes M1/M2, Cytosolic thyroid hormone-binding protein, Opa-interacting protein 3, Pyruvate kinase 2/3, Pyruvate kinase muscle isozyme, Thyroid hormone-binding protein 1, Tumor M2-PK, p58) (Biotin) discontinued
Sign In for Pricing
View Details