Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)
Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.
Product Specifications
Product Name Alternative
Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html
Purity
97.00
Smiles
GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
Molecular Formula
21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)
Molecular Weight
Approximately 27 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx00253-1mgEcoli 1 mg (E. coli)
Recombinant Clostridium Pasteurianum Unknown Protein CP 39 from 2D-PAGE (aa 1-12)
Sign In for Pricing
View Details TL700152V 500 µL Each
Olr853 Rat shRNA Lentiviral Particle (Locus ID 298038)
Sign In for Pricing
View Details 
FANCA-3110M 50 µg
Recombinant Mouse FANCA Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details A4001-200 200 µg
Anti-5-Hydroxymethylcytosine Polyclonal Antibody (200 µg) 1 µg /µl
Sign In for Pricing
View Details 