Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hspg2 activation kit by CRISPRa
GA202022 1 Kit

Mouse Hspg2 activation kit by CRISPRa

Sign In for Pricing
View Details
PLEKHF2 Protein Vector (Rat) (pPM-C-HA)
PV294616 500 ng

PLEKHF2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ITGA7, NT (ITGA7, Integrin alpha-7, Integrin alpha-7 heavy chain, Integrin alpha-7 light chain, Integrin alpha-7 70kD form) (FITC) discontinued
037138-FITC 200 µL

ITGA7, NT (ITGA7, Integrin alpha-7, Integrin alpha-7 heavy chain, Integrin alpha-7 light chain, Integrin alpha-7 70kD form) (FITC) discontinued

Sign In for Pricing
View Details
Fenthoxon Sulfone
012009 50 mg

Fenthoxon Sulfone

Sign In for Pricing
View Details
Mmu-miR-3073a-3p miRNA Inhibitor
CIM0721-01 10 nmol

Mmu-miR-3073a-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-3073a-3p miRNA Inhibitor
CIM0721-02 20 nmol

Mmu-miR-3073a-3p miRNA Inhibitor

Sign In for Pricing
View Details