Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus Suis rpsF Protein (aa 1-96)
VAng-Cr8355-50gEcoli 50 µg (E. coli)

Recombinant Streptococcus Suis rpsF Protein (aa 1-96)

Sign In for Pricing
View Details
ZNF576 sgRNA CRISPR Lentivector (Human) (Target 2)
K2716403 1.0 µg DNA

ZNF576 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Fbxo24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4786105 3x 1.0 µg

Fbxo24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Carf Mouse qPCR Primer Pair (NM_139150)
MP201584 200 Reactions

Carf Mouse qPCR Primer Pair (NM_139150)

Sign In for Pricing
View Details
21x21mm Flammable GHS Symbols
GHSR21IN 1 Roll

21x21mm Flammable GHS Symbols

Sign In for Pricing
View Details
Gm4955 Mouse siRNA Oligo Duplex (Locus ID 240921)
SR421002 1 Kit

Gm4955 Mouse siRNA Oligo Duplex (Locus ID 240921)

Sign In for Pricing
View Details