Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)
Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.
Product Specifications
Product Name Alternative
Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html
Purity
97.00
Smiles
GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
Molecular Formula
21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)
Molecular Weight
Approximately 27 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6477083-01 0.1 mL
FOXO3A (Forkhead box O3, AF6q21, AF6q21 protein, DKFZp781A0677, FKHRL1, FKHRL1P2, Forkhead box protein O3, Forkhead in rhabdomyosarcoma-like 1, FOXO2, MGC12739, MGC31925) (PE)
Sign In for Pricing
View Details 
MBS6477083-02 5x 0.1 mL
FOXO3A (Forkhead box O3, AF6q21, AF6q21 protein, DKFZp781A0677, FKHRL1, FKHRL1P2, Forkhead box protein O3, Forkhead in rhabdomyosarcoma-like 1, FOXO2, MGC12739, MGC31925) (PE)
Sign In for Pricing
View Details 
VAng-Lsx04581-1mg 1 mg
HBV Surface Antigen (Subtype ad) (Human Plasma)
Sign In for Pricing
View Details NBP3-08808DL594 100 µL
Rabbit Monoclonal SATB2 Antibody (SATB2/4374R) [DyLight 594]
Sign In for Pricing
View Details