Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MDFI (P134) Antibody
A10664 100 µL

Anti-MDFI (P134) Antibody

Sign In for Pricing
View Details
Interleukin 33 (FITC)
548130 200 µL

Interleukin 33 (FITC)

Sign In for Pricing
View Details
EDIL3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0653805 3x 1.0 µg

EDIL3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Klk1b3 Protein Vector (Mouse) (pPB-C-His)
PV194834 500 ng

Klk1b3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Copper Oxychloride
TRC-C685385-50G 50 g

Copper Oxychloride

Sign In for Pricing
View Details
Recombinant Sulfurovum sp. Acetate kinase (ackA)
MBS1023647-01 0.02 mg (E-Coli)

Recombinant Sulfurovum sp. Acetate kinase (ackA)

Sign In for Pricing
View Details