Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf170 (NM_029965) Mouse Tagged ORF Clone Lentiviral Particle
MR221153L4V 200 µL

Rnf170 (NM_029965) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
γ-Secretase Inhibitor I
sc-301796 5 mg

γ-Secretase Inhibitor I

Sign In for Pricing
View Details
Zinc Finger DHHC-Type Containing 2 (ZDHHC2) Antibody
abx217628 100 µg

Zinc Finger DHHC-Type Containing 2 (ZDHHC2) Antibody

Sign In for Pricing
View Details
T Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
46019066 1.0 µg DNA

T Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Arsj (NM_173451) Mouse Tagged Lenti ORF Clone
MR224832L4 10 µg

Arsj (NM_173451) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Secretogranin V (SCG5) Human qPCR Primer Pair (NM_003020)
HP206620 200 Reactions

Secretogranin V (SCG5) Human qPCR Primer Pair (NM_003020)

Sign In for Pricing
View Details