Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Copg2 Rat shRNA Plasmid (Locus ID 301742)
TR705502 1 Kit

Copg2 Rat shRNA Plasmid (Locus ID 301742)

Sign In for Pricing
View Details
Rabbit Monoclonal Antibody against RABAC1 (Clone EPR1747Y)
TA301019 100 µL

Rabbit Monoclonal Antibody against RABAC1 (Clone EPR1747Y)

Sign In for Pricing
View Details
C14orf21 sgRNA CRISPR Lentivector (Human) (Target 2)
K0296703 1.0 µg DNA

C14orf21 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MRPL4 Over-expression Lysate Product
GWB-674892 0.1 mg

MRPL4 Over-expression Lysate Product

Sign In for Pricing
View Details
Monkey Peptidyl-prolyl cis-trans isomerase FKBP1B ELISA Kit
MBS7274875-01 48 Well

Monkey Peptidyl-prolyl cis-trans isomerase FKBP1B ELISA Kit

Sign In for Pricing
View Details
Monkey Peptidyl-prolyl cis-trans isomerase FKBP1B ELISA Kit
MBS7274875-02 96 Well

Monkey Peptidyl-prolyl cis-trans isomerase FKBP1B ELISA Kit

Sign In for Pricing
View Details