Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SUMO-conjugating enzyme UBC9 ELISA Kit
MBS9426608-01 96 Tests

Human SUMO-conjugating enzyme UBC9 ELISA Kit

Sign In for Pricing
View Details
Human SUMO-conjugating enzyme UBC9 ELISA Kit
MBS9426608-02 5x 96 Tests

Human SUMO-conjugating enzyme UBC9 ELISA Kit

Sign In for Pricing
View Details
Sodium Selenite Pentahydrate discontinued. See S5320
289007-01 5 g

Sodium Selenite Pentahydrate discontinued. See S5320

Sign In for Pricing
View Details
Sodium Selenite Pentahydrate discontinued. See S5320
289007-02 100 g

Sodium Selenite Pentahydrate discontinued. See S5320

Sign In for Pricing
View Details
Lenampicillin hydrochloride 10mg
A13686-10 10 mg

Lenampicillin hydrochloride 10mg

Sign In for Pricing
View Details
C21orf45 (MIS18A) (NM_018944) Human Over-expression Lysate
LC412868 20 µg

C21orf45 (MIS18A) (NM_018944) Human Over-expression Lysate

Sign In for Pricing
View Details