Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Malcavernin (66-353, His-tag) Human Protein
AR51316PU-N 250 µg

Malcavernin (66-353, His-tag) Human Protein

Sign In for Pricing
View Details
Rat Eif4h Pre-designed siRNA Set B
SI204346B 1 Each

Rat Eif4h Pre-designed siRNA Set B

Sign In for Pricing
View Details
Ubiquitin carboxyl-terminal hydrolase 15 (USP15) Mouse ELISA Kit
I0082 96 Tests

Ubiquitin carboxyl-terminal hydrolase 15 (USP15) Mouse ELISA Kit

Sign In for Pricing
View Details
Streptopain speB protein
30R-3405 500 ug

Streptopain speB protein

Sign In for Pricing
View Details
Rabbit Polyclonal PTS Antibody [DyLight 650]
NBP3-00276C 0.1 mL

Rabbit Polyclonal PTS Antibody [DyLight 650]

Sign In for Pricing
View Details
UCHL5IP (HAUS7) (NM_017518) Human Recombinant Protein
TP303737M 100 µg

UCHL5IP (HAUS7) (NM_017518) Human Recombinant Protein

Sign In for Pricing
View Details