Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATS2L Protein Vector (Human) (pPM-C-HA)
45240021 500 ng

SPATS2L Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Cdx1 3'UTR Luciferase Stable Cell Line
TU202132 1.0 mL

Cdx1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MZF1 Protein Vector (Rat) (pPB-C-His)
PV284150 500 ng

MZF1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
[One Step] BMP5 Antibody Kit
RK05627 50 µL

[One Step] BMP5 Antibody Kit

Sign In for Pricing
View Details
DNA Pol Delta discontinued
535605-01 30ul

DNA Pol Delta discontinued

Sign In for Pricing
View Details
DNA Pol Delta discontinued
535605-02 100 µL

DNA Pol Delta discontinued

Sign In for Pricing
View Details