Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IPO7 Antibody
GWB-MX248E 50 µg

IPO7 Antibody

Sign In for Pricing
View Details
TTYH2 Protein Vector (Mouse) (pPB-N-His)
PV242939 500 ng

TTYH2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
SNORD100 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2235707 1.0 µg DNA

SNORD100 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human NRBP1 siRNA
abx926376-01 15 nmol

Human NRBP1 siRNA

Sign In for Pricing
View Details
Human NRBP1 siRNA
abx926376-02 30 nmol

Human NRBP1 siRNA

Sign In for Pricing
View Details
Rat CD163 Antibody
GWB-Q01270 0.25 mg

Rat CD163 Antibody

Sign In for Pricing
View Details