Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)
Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.
Product Specifications
Product Name Alternative
Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html
Purity
97.00
Smiles
GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
Molecular Formula
21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)
Molecular Weight
Approximately 27 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
ELI-04954r 96 Tests
Rat 10 kDa heat shock protein,mitochondrial,Hspe1 ELISA KIT
Sign In for Pricing
View Details 
TA334656 100 µL
beta glucuronidase (GUSB) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
HK208370 1 Kit
alpha 1a Adrenergic Receptor (ADRA1A) Human qPCR Template Standard (NM_000680)
Sign In for Pricing
View Details GTR15109321 1 Vial
Lentiviral human WIPF2 shRNA (UAS) - Lentiviral human WIPF2 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details