Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-669d-3p miRNA Agomir
abx883587-01 5 nmol

Mouse mmu-miR-669d-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-669d-3p miRNA Agomir
abx883587-02 10 nmol

Mouse mmu-miR-669d-3p miRNA Agomir

Sign In for Pricing
View Details
Anti-DHRS7 antibody
STJ119469 100 µl

Anti-DHRS7 antibody

Sign In for Pricing
View Details
GPR176 (NM_007223) Human Tagged Lenti ORF Clone
RC220955L4 10 µg

GPR176 (NM_007223) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tbx3 (NM_198052) Mouse Recombinant Protein
PM42510M5 20 µg

Tbx3 (NM_198052) Mouse Recombinant Protein

Sign In for Pricing
View Details
Pirfenidone
RM-P180600-01 10 mg

Pirfenidone

Sign In for Pricing
View Details