Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kelatorphan 100mg
A21884-100 100 mg

Kelatorphan 100mg

Sign In for Pricing
View Details
Butyrylcholinesterase/BCHE, Human (HEK293, His)
HY-P7690-01 20 µg

Butyrylcholinesterase/BCHE, Human (HEK293, His)

Sign In for Pricing
View Details
Butyrylcholinesterase/BCHE, Human (HEK293, His)
HY-P7690-02 50 µg

Butyrylcholinesterase/BCHE, Human (HEK293, His)

Sign In for Pricing
View Details
Phospho-CDK6 (Tyr13) Polyclonal Antibody, PerCP Conjugated
bs-5286R-PerCP 100 µL

Phospho-CDK6 (Tyr13) Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Vasoactive Intestinal Polypeptide Receptor 2, Rat, Control Peptide (VIP Receptor 2, VIP2R, VIPR2, Helodermin Preferring VIP Receptor, Helodermin-preferring VIP Receptor, Pituitary Adenylate Cyclase Activating Polypeptide Type III Receptor, PACAP Type III Receptor, VPAC2, VPAC2 Receptor)
V2115-26B 100 µg

Vasoactive Intestinal Polypeptide Receptor 2, Rat, Control Peptide (VIP Receptor 2, VIP2R, VIPR2, Helodermin Preferring VIP Receptor, Helodermin-preferring VIP Receptor, Pituitary Adenylate Cyclase Activating Polypeptide Type III Receptor, PACAP Type III Receptor, VPAC2, VPAC2 Receptor)

Sign In for Pricing
View Details
Human TM7SF2 (NM_003273) AAV Particle
RC202116A1V 250 µL

Human TM7SF2 (NM_003273) AAV Particle

Sign In for Pricing
View Details