Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syncytial Virus Inhibitor-1
MBS3843510-01 1 mg

Syncytial Virus Inhibitor-1

Sign In for Pricing
View Details
Syncytial Virus Inhibitor-1
MBS3843510-02 5 mg

Syncytial Virus Inhibitor-1

Sign In for Pricing
View Details
Syncytial Virus Inhibitor-1
MBS3843510-03 10 mg

Syncytial Virus Inhibitor-1

Sign In for Pricing
View Details
Syncytial Virus Inhibitor-1
MBS3843510-04 5x 10 mg

Syncytial Virus Inhibitor-1

Sign In for Pricing
View Details
B3GNTL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0164607 1.0 µg DNA

B3GNTL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Cnot6 ORF Vector (Rat) (pORF)
ORF065214 1.0 µg DNA

Cnot6 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details