Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KDEL Antibody (2C1) [Alexa Fluor 647]
NBP2-61926AF647 100 µL

Mouse Monoclonal KDEL Antibody (2C1) [Alexa Fluor 647]

Sign In for Pricing
View Details
MLH1 (MutL Homolog 1, MutL Protein Homolog 1, COCA2, DNA Mismatch Repair Protein Mlh1, FCC2, hMLH1, HNPCC, HNPCC2, MGC5172, MutL Homolog 1 Colon Cancer Nonpolyposis Type 2) (PE)
129719-PE 100 µL

MLH1 (MutL Homolog 1, MutL Protein Homolog 1, COCA2, DNA Mismatch Repair Protein Mlh1, FCC2, hMLH1, HNPCC, HNPCC2, MGC5172, MutL Homolog 1 Colon Cancer Nonpolyposis Type 2) (PE)

Sign In for Pricing
View Details
Glutathione Peroxidase 8 (GPX8) Antibody
abx233625 100 µg

Glutathione Peroxidase 8 (GPX8) Antibody

Sign In for Pricing
View Details
KCNE1L sgRNA CRISPR Lentivector set (Human)
K1118401 3x 1.0 µg

KCNE1L sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Cat Adenosine Diphosphate (ADP) ELISA Kit
YLA0017CT-01 48 Tests

Cat Adenosine Diphosphate (ADP) ELISA Kit

Sign In for Pricing
View Details
Cat Adenosine Diphosphate (ADP) ELISA Kit
YLA0017CT-02 96 Tests

Cat Adenosine Diphosphate (ADP) ELISA Kit

Sign In for Pricing
View Details