Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1562533 AAV Vector (Rat) (CMV)
39288106 1 µg

RGD1562533 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone
RC210966 10 µg

Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone

Sign In for Pricing
View Details
HAUS4 Human siRNA Oligo Duplex (Locus ID 54930)
SR310353 1 Kit

HAUS4 Human siRNA Oligo Duplex (Locus ID 54930)

Sign In for Pricing
View Details
Recombinant Monkeypox virus/MPXV D6L Protein, N-His
E55P4101 50 µg

Recombinant Monkeypox virus/MPXV D6L Protein, N-His

Sign In for Pricing
View Details
GDNF Receptor alpha 2 (GFRA2) (NM_001165039) Human Tagged Lenti ORF Clone
RC228263L4 10 µg

GDNF Receptor alpha 2 (GFRA2) (NM_001165039) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
EXTL1 Over-expression Lysate Product
GWB-D208F0 0.1 mg

EXTL1 Over-expression Lysate Product

Sign In for Pricing
View Details