Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)
Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.
Product Specifications
Product Name Alternative
Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html
Purity
97.00
Smiles
GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
Molecular Formula
21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)
Molecular Weight
Approximately 27 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7217642-01 48 Well
Goat BRCA1-associated protein (BRAP) ELISA Kit
Sign In for Pricing
View Details 
MBS7217642-02 96 Well
Goat BRCA1-associated protein (BRAP) ELISA Kit
Sign In for Pricing
View Details MBS7217642-03 5x 96 Well
Goat BRCA1-associated protein (BRAP) ELISA Kit
Sign In for Pricing
View Details 
MBS7217642-04 10x 96 Well
Goat BRCA1-associated protein (BRAP) ELISA Kit
Sign In for Pricing
View Details CK-bio-28714-01 48 Tests
Sheep Aspartate Aminotransferase (AST) ELISA Kit
Sign In for Pricing
View Details 
CK-bio-28714-02 96 Tests
Sheep Aspartate Aminotransferase (AST) ELISA Kit
Sign In for Pricing
View Details