Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Renin (REN) ELISA Kit
MBS4502216-01 48 Tests

Human Renin (REN) ELISA Kit

Sign In for Pricing
View Details
Human Renin (REN) ELISA Kit
MBS4502216-02 96 Tests

Human Renin (REN) ELISA Kit

Sign In for Pricing
View Details
Human Renin (REN) ELISA Kit
MBS4502216-03 5x 96 Tests

Human Renin (REN) ELISA Kit

Sign In for Pricing
View Details
Human Renin (REN) ELISA Kit
MBS4502216-04 10x 96 Tests

Human Renin (REN) ELISA Kit

Sign In for Pricing
View Details
Gtpbp5 (BC025144) Mouse Recombinant Protein
TP502797 20 µg

Gtpbp5 (BC025144) Mouse Recombinant Protein

Sign In for Pricing
View Details
Serclutamab Biosimilar - Research Grade
ICH5853-5mg 5 mg

Serclutamab Biosimilar - Research Grade

Sign In for Pricing
View Details