Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc, solution)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse-his-myc-solution.html

Purity

97.00

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO2, CT (SUMO2, SMT3A, SMT3H2, Small ubiquitin-related modifier 2, HSMT3, SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like protein SMT3A) (FITC) discontinued
042477-FITC 200 µL

SUMO2, CT (SUMO2, SMT3A, SMT3H2, Small ubiquitin-related modifier 2, HSMT3, SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like protein SMT3A) (FITC) discontinued

Sign In for Pricing
View Details
UBE2J1 Knockout Cell Lysate
ABC-KC2235 100 µg

UBE2J1 Knockout Cell Lysate

Sign In for Pricing
View Details
GENLISA™ Human Double-stranded RNA-specific adenosine deaminase (ADAR) ELISA
KBH5203 1x 96 Well

GENLISA™ Human Double-stranded RNA-specific adenosine deaminase (ADAR) ELISA

Sign In for Pricing
View Details
MTUS1 (NM_001001931) Human Over-expression Lysate
LH03236V 100 µg

MTUS1 (NM_001001931) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal PMS2 Antibody
NBP2-56511-25ul 25 µL

Rabbit Polyclonal PMS2 Antibody

Sign In for Pricing
View Details
Dhps Rat shRNA Plasmid (Locus ID 288923)
TL700547 1 Kit

Dhps Rat shRNA Plasmid (Locus ID 288923)

Sign In for Pricing
View Details