Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Myoglobin, Human (His)

Myoglobin Protein, a globin family member, reserves oxygen and facilitates its movement in muscles. Myoglobin Protein, Human (His) is the recombinant human-derived Myoglobin protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Myoglobin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/myoglobin-protein-human-his.html

Purity

97.00

Smiles

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

Molecular Formula

4151 (Gene_ID) P02144 (M1-G154) (Accession)

Molecular Weight

Approximately 18.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tube holder, 4 x 10-15ml, 2/pk (1 pack included)
R2020-150 1 Each

Tube holder, 4 x 10-15ml, 2/pk (1 pack included)

Sign In for Pricing
View Details
ZNHIT1 Rabbit Polyclonal Antibody
TA365182 100 µL

ZNHIT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-418
BCPS-418 1 Unit

Large Capacity Water Purification System BCPS-418

Sign In for Pricing
View Details
ENDOD1 Human Gene Knockout Kit (CRISPR)
KN417810 1 Kit

ENDOD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Wnt3a Mouse Gene Knockout Kit (CRISPR)
KN519453 1 Kit

Wnt3a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS700984 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details