Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Myoglobin, Human (His)

Myoglobin Protein, a globin family member, reserves oxygen and facilitates its movement in muscles. Myoglobin Protein, Human (His) is the recombinant human-derived Myoglobin protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Myoglobin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/myoglobin-protein-human-his.html

Purity

97.00

Smiles

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

Molecular Formula

4151 (Gene_ID) P02144 (M1-G154) (Accession)

Molecular Weight

Approximately 18.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Perfringens pth Protein (aa 1-188)
VAng-Lsx00670-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Perfringens pth Protein (aa 1-188)

Sign In for Pricing
View Details
COQ10A Protein Vector (Mouse) (pPM-C-HA)
PV167372 500 ng

COQ10A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ARMC6 Antibody
E314506 100 µg - 200 µL

ARMC6 Antibody

Sign In for Pricing
View Details
Kcne4 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7293303 1.0 µg DNA

Kcne4 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
TRNAQ9 Protein Vector (Human) (pPB-N-His)
PV139995 500 ng

TRNAQ9 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
DOC2B Antibody
A54996-100UG 100 µg

DOC2B Antibody

Sign In for Pricing
View Details