Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Myoglobin, Human (His)

Myoglobin Protein, a globin family member, reserves oxygen and facilitates its movement in muscles. Myoglobin Protein, Human (His) is the recombinant human-derived Myoglobin protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Myoglobin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/myoglobin-protein-human-his.html

Purity

97.00

Smiles

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

Molecular Formula

4151 (Gene_ID) P02144 (M1-G154) (Accession)

Molecular Weight

Approximately 18.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GTPBP2 Knockout HEK293T cell line
GTR15406464 1 Vial

Human GTPBP2 Knockout HEK293T cell line

Sign In for Pricing
View Details
ME2 siRNA Oligos set (Human)
28278171 3x 5 nmol

ME2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
RETREG1 Human Gene Knockout Kit (CRISPR)
KN408619 1 Kit

RETREG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human LPXN Protein
E30P65438A 50 µg

Recombinant Human LPXN Protein

Sign In for Pricing
View Details
PATL1 Knockout 786-O Polyclonal Cells
ARG4911 1 Million

PATL1 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Human GMDS Protein, N-His
HT191012-01 50 µg

Recombinant Human GMDS Protein, N-His

Sign In for Pricing
View Details