Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DR6/TNFRSF21, Rat (HEK293, Fc)

DR6/TNFRSF21 protein is the core of apoptosis and may activate NF-kappa-B and promote BAX-mediated apoptosis through cytochrome c release. In neuronal apoptosis, it responds to amyloid peptides in APP, which is critical for cell body death and axonal pruning. DR6/TNFRSF21 Protein, Rat (HEK293, Fc) is the recombinant rat-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

DR6/TNFRSF21 Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dr6-tnfrsf21-protein-rat-hek293-fc.html

Purity

98.00

Smiles

QPEQKTLSLTGTYRHVDRTTGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPSGTFTRHENGIERCHDCSQPCPRPMIERLPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVPSSVMKCRAHTDCLGQNLMVVKQGTKETDNVCGVHLSSSSTTPSSPGIATFSHPEHTESHDVPSSTYEPQGMNSTDSNSTASVRTKVPSDIQEETVPDNTSSTSGKESTNRTLPNPPQLTHQQGPHHRHILKLLPSSMEATGEKSSTAIKAPKRGHPRQNPHKHFDINEH

Molecular Formula

316256 (Gene_ID) D3ZF92 (Q42-H349) (Accession)

Molecular Weight

Approximately 95-115 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pOTB7-NTN5-1 Plasmid
PVT29764 2 µg

pOTB7-NTN5-1 Plasmid

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase (menD), partial
MBS1296948 Inquire

Recombinant Prochlorococcus marinus 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase (menD), partial

Sign In for Pricing
View Details
KPNA5 siRNA (Human)
CRH2604-01 15 nmol

KPNA5 siRNA (Human)

Sign In for Pricing
View Details
KPNA5 siRNA (Human)
CRH2604-02 30 nmol

KPNA5 siRNA (Human)

Sign In for Pricing
View Details
Glutamine Synthetase Mouse mAb
E2222302 100 µL

Glutamine Synthetase Mouse mAb

Sign In for Pricing
View Details
Beta tubulin Monoclonal Antibody, AbBy Fluor™ 405 Conjugated
bsm-33034M-BF405 100 µL

Beta tubulin Monoclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details