Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spindlin-4 (SPIN4), partial

Product Specifications

Abbreviation

Recombinant Human SPIN4 protein, partial

Gene Name

SPIN4

UniProt

Q56A73

Expression Region

36-249aa

Organism

Homo sapiens (Human)

Target Sequence

TRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Exhibits H3K4me3-binding activity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.7 kDa

References & Citations

"A transcriptional coregulator, SPIN-DOC, attenuates the coactivator activity of Spindlin1." Bae N., Gao M., Li X., Premkumar T., Sbardella G., Chen J., Bedford M.T. J. Biol. Chem. 292:20808-20817 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PUF60 (poly-U Binding Splicing Factor 60kD, FIR, FLJ31379, RoBPI, SIAHBP1) (MaxLight 550)
MBS6218846-01 0.1 mL

PUF60 (poly-U Binding Splicing Factor 60kD, FIR, FLJ31379, RoBPI, SIAHBP1) (MaxLight 550)

Sign In for Pricing
View Details
PUF60 (poly-U Binding Splicing Factor 60kD, FIR, FLJ31379, RoBPI, SIAHBP1) (MaxLight 550)
MBS6218846-02 5x 0.1 mL

PUF60 (poly-U Binding Splicing Factor 60kD, FIR, FLJ31379, RoBPI, SIAHBP1) (MaxLight 550)

Sign In for Pricing
View Details
ERO1LB, CT (ERO1LB, ERO1-like protein beta, Endoplasmic oxidoreductin-1-like protein B, Oxidoreductin-1-L-beta) (MaxLight 650)
MBS6296654-01 0.1 mL

ERO1LB, CT (ERO1LB, ERO1-like protein beta, Endoplasmic oxidoreductin-1-like protein B, Oxidoreductin-1-L-beta) (MaxLight 650)

Sign In for Pricing
View Details
ERO1LB, CT (ERO1LB, ERO1-like protein beta, Endoplasmic oxidoreductin-1-like protein B, Oxidoreductin-1-L-beta) (MaxLight 650)
MBS6296654-02 5x 0.1 mL

ERO1LB, CT (ERO1LB, ERO1-like protein beta, Endoplasmic oxidoreductin-1-like protein B, Oxidoreductin-1-L-beta) (MaxLight 650)

Sign In for Pricing
View Details
PAH Rabbit Polyclonal Antibody (Fluoro550)
orb3116939 100 µg

PAH Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
UBE2Z (Ubiquitin-conjugating Enzyme E2Z, FLJ13855, HOYS7, USE1) (Biotin)
253223-Biotin 100 µL

UBE2Z (Ubiquitin-conjugating Enzyme E2Z, FLJ13855, HOYS7, USE1) (Biotin)

Sign In for Pricing
View Details