Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRX1/Glutaredoxin 1, Human (His)

GRX1 (Glutaredoxin 1) acts as a glutathione-disulfide oxidoreductase with NADPH and glutathione reductase. It functions by reducing both low molecular weight disulfides and proteins. GRX1/Glutaredoxin 1 Protein, Human (His) is the recombinant human-derived GRX1/Glutaredoxin 1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GRX1/Glutaredoxin 1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/grx1-glutaredoxin-1-protein-human-his.html

Purity

95.20

Smiles

MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

Molecular Formula

2745 (Gene_ID) P35754 (M1-Q106) (Accession)

Molecular Weight

Approximately 14 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gip-set siRNA/shRNA/RNAi Lentivector (Rat)
21524096 4x 500 ng

Gip-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
CD2/SRBC Protein, Human, Recombinant (C-His)
E51P00522 100 µg

CD2/SRBC Protein, Human, Recombinant (C-His)

Sign In for Pricing
View Details
Anti-Ficolin 1/FCN1 Antibody (5G796)
TMAY-01341 100 µL

Anti-Ficolin 1/FCN1 Antibody (5G796)

Sign In for Pricing
View Details
PAI-2 Double Nickase Plasmid (m)
sc-422288-NIC 20 µg

PAI-2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
3-Fluoro-4-phenylphenol
TRC-F600668-100MG 100 mg

3-Fluoro-4-phenylphenol

Sign In for Pricing
View Details
Mouse Slbp Pre-designed siRNA Set B
SI112983B 1 Each

Mouse Slbp Pre-designed siRNA Set B

Sign In for Pricing
View Details