Galectin-9/LGALS9, Mouse (GST)
Product Specifications
UNSPSC Description
The Galectin-9/LGALS9 protein is an eosinophil chemoattractant that directs the migration of eosinophils, key immune cells in the inflammatory response.It also acts as an angiogenesis inhibitor, regulating blood vessel formation.Galectin-9/LGALS9 Protein, Mouse (GST) is the recombinant mouse-derived Galectin-9/LGALS9 protein, expressed by E.coli , with N-GST labeled tag.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/galectin-9-protein-mouse-gst.html
Purity
97.84
Smiles
MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT
Molecular Weight
Approximately 60.0 kDa
Shipping Conditions
Dry Ice
Storage Conditions
Stored at -80°C for 1 year
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
042006-ML490 100 µL
SLFN12, ID (SLFN12, Schlafen family member 12) (MaxLight 490)
Sign In for Pricing
View Details 
MBS7077948 Inquire
Recombinant Lumbricus terrestris ATP synthase subunit a (ATP6), partial
Sign In for Pricing
View Details