Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galectin-9/LGALS9, Mouse (GST)

Product Specifications

UNSPSC Description

The Galectin-9/LGALS9 protein is an eosinophil chemoattractant that directs the migration of eosinophils, key immune cells in the inflammatory response.It also acts as an angiogenesis inhibitor, regulating blood vessel formation.Galectin-9/LGALS9 Protein, Mouse (GST) is the recombinant mouse-derived Galectin-9/LGALS9 protein, expressed by E.coli , with N-GST labeled tag.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galectin-9-protein-mouse-gst.html

Purity

97.84

Smiles

MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Dry Ice

Storage Conditions

Stored at -80°C for 1 year

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-bovine NGF IgG fraction (polyclonal)
PA-023-9 1 mg

Rabbit anti-bovine NGF IgG fraction (polyclonal)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)
MBS2169377-01 0.1 mL

Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)
MBS2169377-02 0.2 mL

Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)
MBS2169377-03 0.5 mL

Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)
MBS2169377-04 1 mL

Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)
MBS2169377-05 5 mL

Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)

Sign In for Pricing
View Details