Galectin-9/LGALS9, Mouse (GST)
Product Specifications
UNSPSC Description
The Galectin-9/LGALS9 protein is an eosinophil chemoattractant that directs the migration of eosinophils, key immune cells in the inflammatory response.It also acts as an angiogenesis inhibitor, regulating blood vessel formation.Galectin-9/LGALS9 Protein, Mouse (GST) is the recombinant mouse-derived Galectin-9/LGALS9 protein, expressed by E.coli , with N-GST labeled tag.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/galectin-9-protein-mouse-gst.html
Purity
97.84
Smiles
MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT
Molecular Weight
Approximately 60.0 kDa
Shipping Conditions
Dry Ice
Storage Conditions
Stored at -80°C for 1 year
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
CC020A/B 1 Each
Freeze-dried 17 Types of Human Papillomavirus (16/18/6/11/44 Typing) Nucleic Acid
Sign In for Pricing
View Details V2143 1 mg
Vitamin K1-18O_x000B_ (Mixture of 1-18O and 4-18O) (2-Methyl-3-[ (2E,7R,11R) -3,7,11,15-tetramethyl-2-hexadecenyl]-1,4-naphthalene-dione-18O, Vitamin K1-18O, Phytonadione-18O)
Sign In for Pricing
View Details