Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apis mellifera carnica Defensin-1

Product Specifications

Product Name Alternative

Defensin-1

Abbreviation

Recombinant Apis mellifera carnica Defensin-1 protein

UniProt

Q5J8R1

Expression Region

44-94aa

Organism

Apis mellifera carnica (Carniolan honeybee)

Target Sequence

VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRF

Tag

N-terminal 6xHis-KSI-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Found in royal jelly and in hemolymph, potent antibacterial protein against Gram-positive bacteria at low concentration.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.9 kDa

References & Citations

"Silencing of Apis mellifera dorsal genes reveals their role in expression of the antimicrobial peptide defensin-1." Lourenco A.P., Florecki M.M., Simoes Z.L.P., Evans J.D. Insect Mol Biol 27:577-589 (2018)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-100 1x 100 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-500 1x 500 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-500 1x 500 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-100 1x 100 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
BNC400096-100 1x 100 µL

Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details