What is the catalog number for MEC/CCL28, Human?

The catalog number for MEC/CCL28, Human is HY-P7250.

What sizes are available for MEC/CCL28, Human?

MEC/CCL28, Human is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg, 500 µg.

How many pack sizes does MEC/CCL28, Human come in?

MEC/CCL28, Human is available in 5 different pack sizes.

Is MEC/CCL28, Human in stock?

MEC/CCL28, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures MEC/CCL28, Human?

MEC/CCL28, Human is manufactured by QuantiMol.

What is the estimated delivery time for MEC/CCL28, Human?

Estimated delivery time for MEC/CCL28, Human is approximately 15 business day(s), depending on your location.

MEC/CCL28, Human

MEC/CCL28 Protein, Human is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Human is a recombinant human MEC/CCL28 (S20-Y127) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MEC/CCL28 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/recombinant-human-mec-ccl28.html

Purity

97.00

Smiles

SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Molecular Formula

56477 (Gene_ID) Q9NRJ3-1 (S20-Y127) (Accession)

Molecular Weight

Approximately 13-15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Meurens F, et al. Expression of mucosal chemokines TECK/CCL25 and MEC/CCL28 during fetal development of the ovine mucosal immune system. Immunology. 2007 Apr;120 (4) :544-55.|[2]Hiroyuki Ogawa, et al. Regulated production of the chemokine CCL28 in human colon epithelium. Am J Physiol Gastrointest Liver Physiol. 2004 Nov;287 (5) :G1062-9.|[3]Teena Mohan, et al. CCL28 chemokine: An anchoring point bridging innate and adaptive immunity. Int Immunopharmacol. 2017 Oct;51:165-170.|[4]Chan Sun, et al. Chemokine CCL28 induces apoptosis of decidual stromal cells via binding CCR3/CCR10 in human spontaneous abortion. Mol Hum Reprod. 2013 Oct;19 (10) :676-86.|[5]Malin Hansson, et al. CCL28 is increased in human Helicobacter pylori-induced gastritis and mediates recruitment of gastric immunoglobulin A-secreting cells. Infect Immun. 2008 Jul;76 (7) :3304-11.|[6]Chen Z, et al. Characterising the expression and function of CCL28 and its corresponding receptor, CCR10, in RA pathogenesis. Ann Rheum Dis. 2015 Oct;74 (10) :1898-906.