Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Anoctamin-1 (ANO1), partial

Product Specifications

Product Name Alternative

(Discovered on gastrointestinal stromal tumors protein 1) (Oral cancer overexpressed protein 2) (Transmembrane protein 16A) (Tumor-amplified and overexpressed sequence 2)

Abbreviation

Recombinant Human ANO1 protein, partial

Gene Name

ANO1

UniProt

Q5XXA6

Expression Region

806-892aa

Organism

Homo sapiens (Human)

Target Sequence

SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Calcium-activated chloride channel (CaCC) . Plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development. Required for CFTR activation by enhancing endoplasmic reticulum Ca (2+) store release and is also required for CFTR membrane expression. Required for basal and ATP-dependent mucus secretion in airways and intestine, probably by controlling exocytosis of mucus-filled granules by providing Ca (2+) to an apical signaling compartment. Contributes to airway mucus expression induced by interleukins IL3 and IL8 and by the asthma-associated protein CLCA1 and is required for expression of mucin MUC5AC. However, was shown in another study not to be required for MUC5AC expression. Plays a role in the propagation of Ca (2+) waves in Kolliker's organ in the cochlea and contributes to the refinement of auditory brainstem circuitries prior to hearing onset. In vomeronasal sensory neurons, modulates spontaneous firing patterns in the absence of stimuli as well as the firing pattern of pheromone-evoked activity. Responsible for calcium-activated chloride channel activity in type I taste cells of the vallate papillae. Acts as a heat sensor in nociceptive neurons. In dorsal root ganglion neurons, plays a role in mediating non-histaminergic Mas-related G-protein coupled receptor (MRGPR) -dependent itching, acting as a downstream effector of MRGPRs. In the developing brain, required for the Ca (2+) -dependent process extension of radial glial cells. ; [Isoform 4]: Calcium-activated chloride channel (CaCC) . Contributes to calcium-activated chloride secretion in human sweat gland epithelial cells. Shows increased basal chloride permeability and decreased Ca (2+) -induced chloride permeability. ; [Isoform 5]: Calcium-activated chloride channel (CaCC) . Shows increased sensitivity to intracellular Ca (2+) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.6 kDa

References & Citations

"The novel marker, DOG1, is expressed ubiquitously in gastrointestinal stromal tumors irrespective of KIT or PDGFRA mutation status." West R.B., Corless C.L., Chen X., Rubin B.P., Subramanian S., Montgomery K., Zhu S., Ball C.A., Nielsen T.O., Patel R., Goldblum J.R., Brown P.O., Heinrich M.C., van de Rijn M. Am. J. Pathol. 165:107-113 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4’-Hydroxyacetophenone Oxime
TRC-H741050-25MG 25 mg

4’-Hydroxyacetophenone Oxime

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR562637 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
1-Boc-hexahydro-1,4-diazepine
TRC-B656175-5G 5 g

1-Boc-hexahydro-1,4-diazepine

Sign In for Pricing
View Details
2-Morpholinecarboxylic Acid Ethyl Ester
TRC-M723785-500MG 500 mg

2-Morpholinecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
KRT24 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F10]
TA802896AM 100 µL

KRT24 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F10]

Sign In for Pricing
View Details
PPP4C Human Gene Knockout Kit (CRISPR)
KN400538 1 Kit

PPP4C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details