Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAFF/TNFSF13B, Human (His-SUMO)

BAFF/TNFSF13B protein is a cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA, forming a key ligand-receptor pathway together with TNFSF13/APRIL. These interactions play a crucial role in stimulating B-cell and T-cell function and regulating humoral immunity. BAFF/TNFSF13B Protein, Human (His-SUMO) is the recombinant human-derived BAFF/TNFSF13B protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

BAFF/TNFSF13B Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/baff-tnfsf13b-protein-human-his-sumo.html

Smiles

QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

Molecular Formula

10673 (Gene_ID) Q9Y275-1 (Q68-L285) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eriodictyol
TRC-E600085-1MG 1 mg

Eriodictyol

Sign In for Pricing
View Details
ARHGAP22 Human Gene Knockout Kit (CRISPR)
KN420614 1 Kit

ARHGAP22 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MST1 Mouse Monoclonal Antibody [Clone ID: OTI4B12]
CF808369 100 µg

MST1 Mouse Monoclonal Antibody [Clone ID: OTI4B12]

Sign In for Pricing
View Details
C20orf7 (NDUFAF5) (NM_001039375) Human Over-expression Lysate
LY422042 100 µg

C20orf7 (NDUFAF5) (NM_001039375) Human Over-expression Lysate

Sign In for Pricing
View Details
BMP10 Human Gene Knockout Kit (CRISPR)
KN415695 1 Kit

BMP10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPL31 (Center) Rabbit Polyclonal Antibody
AP53716PU-N 400 µL

RPL31 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details