Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAFF/TNFSF13B, Human (His-SUMO)

BAFF/TNFSF13B protein is a cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA, forming a key ligand-receptor pathway together with TNFSF13/APRIL. These interactions play a crucial role in stimulating B-cell and T-cell function and regulating humoral immunity. BAFF/TNFSF13B Protein, Human (His-SUMO) is the recombinant human-derived BAFF/TNFSF13B protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

BAFF/TNFSF13B Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/baff-tnfsf13b-protein-human-his-sumo.html

Smiles

QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

Molecular Formula

10673 (Gene_ID) Q9Y275-1 (Q68-L285) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKRD60 activation kit by CRISPRa
GA115400 1 Kit

Human ANKRD60 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS631285 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Mouse Sypl activation kit by CRISPRa
GA203347 1 Kit

Mouse Sypl activation kit by CRISPRa

Sign In for Pricing
View Details
JNK1 Rabbit Polyclonal Antibody
R1309-1 100 µL

JNK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PKC alpha (PRKCA) Rabbit Monoclonal Antibody
TA422902 100 µL

PKC alpha (PRKCA) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ERG (NM_182918) Human Over-expression Lysate
LC403650 20 µg

ERG (NM_182918) Human Over-expression Lysate

Sign In for Pricing
View Details