Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBL2/COLEC1, Human (HEK293, His)

The MBL2/COLEC1 protein is a calcium-dependent lectin in innate immune defense that activates the lectin complement pathway by binding to mannose, fucose, and N-acetylglucosamine on microorganisms. MBL2/COLEC1 Protein, Human (HEK293, His) is the recombinant human-derived MBL2/COLEC1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MBL2/COLEC1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mbl-2-mbp-c-protein-human-hek-293-his.html

Purity

98.0

Smiles

ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Molecular Formula

4153 (Gene_ID) P11226 (E21-I248) (Accession)

Molecular Weight

Approximately 31-32.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Adenosine A2b Receptor (ADORA2b) ELISA Kit
DL-ADORA2b-Hu-01 48 Tests

Human Adenosine A2b Receptor (ADORA2b) ELISA Kit

Sign In for Pricing
View Details
Human Adenosine A2b Receptor (ADORA2b) ELISA Kit
DL-ADORA2b-Hu-02 96 Tests

Human Adenosine A2b Receptor (ADORA2b) ELISA Kit

Sign In for Pricing
View Details
MBD3 Protein Vector (Rat) (pPB-C-His)
PV281330 500 ng

MBD3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PGC1 β Rabbit Monoclonal Antibody
AMRe21495-01 50 µL

PGC1 β Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PGC1 β Rabbit Monoclonal Antibody
AMRe21495-02 100 µL

PGC1 β Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PGC1 β Rabbit Monoclonal Antibody
AMRe21495-03 200 µL

PGC1 β Rabbit Monoclonal Antibody

Sign In for Pricing
View Details