Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPS1, Human (His-SUMO)

The PRPS1 protein plays a crucial role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS1 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS1 Protein, Human (His-SUMO) is the recombinant human-derived PRPS1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRPS1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prps1-protein-human-his-sumo.html

Smiles

PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

Molecular Formula

5631 (Gene_ID) P60891-1 (P2-L318) (Accession)

Molecular Weight

50.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEPAI (PMEPA1) (NM_199171) Human Recombinant Protein
TP310261M 100 µg

TMEPAI (PMEPA1) (NM_199171) Human Recombinant Protein

Sign In for Pricing
View Details
L-Cysteic Acid Monohydrate
TRC-C994500-1G 1 g

L-Cysteic Acid Monohydrate

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon: sigmoid
CD563359 5 µg

Tissue Genomic DNA, Colon: sigmoid

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2 + ICO-106), CF640R conjugate, 0.1mg/mL
BNC400735-500 1x 500 µL

Human Lambda Light Chain (LcN-2 + ICO-106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lewis A (7LE), CF647 conjugate, 0.1mg/mL
BNC470311-100 1x 100 µL

Lewis A (7LE), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Myosin Light Chain 1, Alkali, Fast Skeletal (MYL1) ELISA Kit
RD-MYL1-Hu-01 96 Tests

Human Myosin Light Chain 1, Alkali, Fast Skeletal (MYL1) ELISA Kit

Sign In for Pricing
View Details