Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPS1, Human (His-SUMO)

The PRPS1 protein plays a crucial role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS1 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS1 Protein, Human (His-SUMO) is the recombinant human-derived PRPS1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRPS1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prps1-protein-human-his-sumo.html

Smiles

PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

Molecular Formula

5631 (Gene_ID) P60891-1 (P2-L318) (Accession)

Molecular Weight

50.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD172a/b Antibody[SE5A5]
AN00317D-01 20 Tests

PE Anti-Human CD172a/b Antibody[SE5A5]

Sign In for Pricing
View Details
PE Anti-Human CD172a/b Antibody[SE5A5]
AN00317D-02 100 Tests

PE Anti-Human CD172a/b Antibody[SE5A5]

Sign In for Pricing
View Details
PE Anti-Human CD172a/b Antibody[SE5A5]
AN00317D-03 2x 100 Tests

PE Anti-Human CD172a/b Antibody[SE5A5]

Sign In for Pricing
View Details
MMP7 (NM_002423) Human Over-expression Lysate
LC400865 20 µg

MMP7 (NM_002423) Human Over-expression Lysate

Sign In for Pricing
View Details
Calreticulin Recombinant Chimeric Antibody Antibody
HA610363 100 µL

Calreticulin Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
BAMBI Mouse Monoclonal Antibody [Clone ID: OTI9G4]
CF807760 100 µg

BAMBI Mouse Monoclonal Antibody [Clone ID: OTI9G4]

Sign In for Pricing
View Details