Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORO1A sgRNA CRISPR Lentivector (Human) (Target 1)
K0491602 1.0 µg DNA

CORO1A sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GPATCH3 (G Patch Domain-Containing Protein 3)
482072 100 µL

GPATCH3 (G Patch Domain-Containing Protein 3)

Sign In for Pricing
View Details
SLK siRNA Oligos set (Human)
44374171 3x 5 nmol

SLK siRNA Oligos set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 19 Antibody (OTI3F8) [Allophycocyanin]
NBP2-71092APC 0.1 mL

Mouse Monoclonal Cytokeratin 19 Antibody (OTI3F8) [Allophycocyanin]

Sign In for Pricing
View Details
DENND1A Protein Vector (Rat) (pPM-C-HA)
PV263836 500 ng

DENND1A Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RASSF3 Peptide - N-terminal region
MBS3246068-01 0.1 mg

RASSF3 Peptide - N-terminal region

Sign In for Pricing
View Details