Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Bcl-6 Antibody (BCL6/1718) [Janelia Fluor 549]
NBP3-08865JF549 100 µL

Mouse Monoclonal Bcl-6 Antibody (BCL6/1718) [Janelia Fluor 549]

Sign In for Pricing
View Details
Non-sterile MCE Syringe Filters, 5.0 (μm), 25 (mm), GF Prefilter, 100pcs/pk
11038653 100 PCS

Non-sterile MCE Syringe Filters, 5.0 (μm), 25 (mm), GF Prefilter, 100pcs/pk

Sign In for Pricing
View Details
Fc Fragment Of IgG Low Affinity IIIb Receptor (FCGR3B) Antibody
abx172357-01 100 µL

Fc Fragment Of IgG Low Affinity IIIb Receptor (FCGR3B) Antibody

Sign In for Pricing
View Details
Fc Fragment Of IgG Low Affinity IIIb Receptor (FCGR3B) Antibody
abx172357-02 200 µL

Fc Fragment Of IgG Low Affinity IIIb Receptor (FCGR3B) Antibody

Sign In for Pricing
View Details
Fc Fragment Of IgG Low Affinity IIIb Receptor (FCGR3B) Antibody
abx172357-03 1 mL

Fc Fragment Of IgG Low Affinity IIIb Receptor (FCGR3B) Antibody

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Heat Shock Protein 90kDa Alpha B1 (HSP90aB1)
MBS2110007-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Heat Shock Protein 90kDa Alpha B1 (HSP90aB1)

Sign In for Pricing
View Details