Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CNRIP1 Antibody [FITC]
NBP2-81897F 0.1 mL

Rabbit Polyclonal CNRIP1 Antibody [FITC]

Sign In for Pricing
View Details
GENLISA™ Human Metastasis Associated In Colon Cancer 1 (MACC1) ELISA
KBH4098 1x 96 Well

GENLISA™ Human Metastasis Associated In Colon Cancer 1 (MACC1) ELISA

Sign In for Pricing
View Details
ACTH Antibody / Synacthen
V2230-100UG 100 µg

ACTH Antibody / Synacthen

Sign In for Pricing
View Details
Rabbit Monoclonal dsDNA Antibody (DSD/4054R) [PE]
NBP3-08490PE 0.1 mL

Rabbit Monoclonal dsDNA Antibody (DSD/4054R) [PE]

Sign In for Pricing
View Details
Human Heat Shock 70kDa Protein 12B (HSPA12B) ELISA Kit
RD-HSPA12B-Hu-96Tests 96 Tests

Human Heat Shock 70kDa Protein 12B (HSPA12B) ELISA Kit

Sign In for Pricing
View Details
Ptchd1 ORF Vector (Mouse) (pORF)
ORF055151 1.0 µg DNA

Ptchd1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details