Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC22A8 Antibody
ABD7196 100 µg

SLC22A8 Antibody

Sign In for Pricing
View Details
ZFP28 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
50898154 3x 1.0 µg DNA

ZFP28 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Zika Virus Protein 2K Blocking Peptide
MBS5400673-01 0.25 mg

Zika Virus Protein 2K Blocking Peptide

Sign In for Pricing
View Details
Zika Virus Protein 2K Blocking Peptide
MBS5400673-02 5x 0.25 mg

Zika Virus Protein 2K Blocking Peptide

Sign In for Pricing
View Details
Anti-Mouse CD80/B7-1 Antibody (16-10A1)
FME03410 100 μg

Anti-Mouse CD80/B7-1 Antibody (16-10A1)

Sign In for Pricing
View Details
CTNNB1 (C-Term) Rabbit pAb
MBS8557004-01 0.1 mL

CTNNB1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details