Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DKK2 ELISA Kit
E011884 1 Each

Human DKK2 ELISA Kit

Sign In for Pricing
View Details
GPR37L1, NT (GPR37L1, ETBRLP2, Endothelin B receptor-like protein 2, G-protein coupled receptor 37-like 1) (APC) discontinued
036242-APC 200 µL

GPR37L1, NT (GPR37L1, ETBRLP2, Endothelin B receptor-like protein 2, G-protein coupled receptor 37-like 1) (APC) discontinued

Sign In for Pricing
View Details
Caskin2 (NM_080643) Mouse Tagged ORF Clone Lentiviral Particle
MR211797L3V 200 µL

Caskin2 (NM_080643) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Csf1 (NM_007778) Mouse Tagged ORF Clone
MR226827 10 µg

Csf1 (NM_007778) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Goat Carbohydrate Antigen 125 ELISA Kit
MBS742029-01 48 Well

Goat Carbohydrate Antigen 125 ELISA Kit

Sign In for Pricing
View Details
Goat Carbohydrate Antigen 125 ELISA Kit
MBS742029-02 96 Well

Goat Carbohydrate Antigen 125 ELISA Kit

Sign In for Pricing
View Details