Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3TC2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
43688064 1.0 µg DNA

SH3TC2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SMNDC1 3'UTR Luciferase Stable Cell Line
TU023744 1.0 mL

SMNDC1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Sirtuin 6 (SIRT6, NAD-dependent Protein Deacetylase Sirtuin-6, Regulatory Protein SIR2 Homolog 6, SIR2-like Protein 6, SIR2L6) (FITC)
133368-FITC 100 µL

Sirtuin 6 (SIRT6, NAD-dependent Protein Deacetylase Sirtuin-6, Regulatory Protein SIR2 Homolog 6, SIR2-like Protein 6, SIR2L6) (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal SPEN Antibody [DyLight 680]
NB100-58799FR 0.1 mL

Rabbit Polyclonal SPEN Antibody [DyLight 680]

Sign In for Pricing
View Details
Chicken Myosin Heavy Chain (MHC) ELISA Kit
MBS9364304 Inquire

Chicken Myosin Heavy Chain (MHC) ELISA Kit

Sign In for Pricing
View Details
A2AP discontinued
532587-01 30ul

A2AP discontinued

Sign In for Pricing
View Details