Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBMS3 cDNA Clone
MBS1277109-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

RBMS3 cDNA Clone

Sign In for Pricing
View Details
RBMS3 cDNA Clone
MBS1277109-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

RBMS3 cDNA Clone

Sign In for Pricing
View Details
MS4A12 (Membrane-spanning 4-domains Subfamily A Member 12, FLJ20217, Ms4a10) (PE)
129904-PE 100 µL

MS4A12 (Membrane-spanning 4-domains Subfamily A Member 12, FLJ20217, Ms4a10) (PE)

Sign In for Pricing
View Details
ACAT1 (Acetyl-CoA Acetyltransferase, Mitochondrial, Acetoacetyl-CoA Thiolase, T2, ACAT, MAT) (FITC)
122857-FITC 100 µL

ACAT1 (Acetyl-CoA Acetyltransferase, Mitochondrial, Acetoacetyl-CoA Thiolase, T2, ACAT, MAT) (FITC)

Sign In for Pricing
View Details
IL17D (Interleukin-17D, IL-17D, Interleukin-27, IL-27, IL27, UNQ3096/PRO21175, FLJ30846) (MaxLight 650)
128408-ML650 100 µL

IL17D (Interleukin-17D, IL-17D, Interleukin-27, IL-27, IL27, UNQ3096/PRO21175, FLJ30846) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis ureG Protein (aa 1-224)
VAng-Yyj3204-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Bovis ureG Protein (aa 1-224)

Sign In for Pricing
View Details