Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F4]
TA500700AM 100 µL

Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F4]

Sign In for Pricing
View Details
Mouse Monoclonal CCNY Antibody (OTI12F10) [DyLight 405]
NBP2-72462V 0.1 mL

Mouse Monoclonal CCNY Antibody (OTI12F10) [DyLight 405]

Sign In for Pricing
View Details
SCA26 sgRNA CRISPR Lentivector (Human) (Target 2)
K2093303 1.0 µg DNA

SCA26 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
AKAP2/PALM2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-9028R-BF405 100 µL

AKAP2/PALM2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Lentiviral human CDKN3 sgRNA gene knockout kit - Lentiviral human CDKN3 sgRNA gene knockout kit (plasmid)
GTR15354745 1 Vial

Lentiviral human CDKN3 sgRNA gene knockout kit - Lentiviral human CDKN3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
GSTM5 (Glutathione S-Transferase Mu 5, GST class-mu 5, GSTM5-5, GTM5) (APC)
127606-APC 100 µL

GSTM5 (Glutathione S-Transferase Mu 5, GST class-mu 5, GSTM5-5, GTM5) (APC)

Sign In for Pricing
View Details