Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti Human Calcitonin Receptor Monoclonal Antibody
CABT-48598MH 0.1 mg

Mouse Anti Human Calcitonin Receptor Monoclonal Antibody

Sign In for Pricing
View Details
ZO-1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-41327R-PE-Cy5 100 µL

ZO-1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
KLRG1 / CLEC15A Monoclonal Antibody
ANT-12922-50ug 50 µg

KLRG1 / CLEC15A Monoclonal Antibody

Sign In for Pricing
View Details
MEIS1-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV732697 1.0 µg DNA

MEIS1-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Monkey Hydroxycarboxylic Acid Receptor 1 (GPR81) ELISA Kit
MBS9937284-01 48 Well

Monkey Hydroxycarboxylic Acid Receptor 1 (GPR81) ELISA Kit

Sign In for Pricing
View Details
Monkey Hydroxycarboxylic Acid Receptor 1 (GPR81) ELISA Kit
MBS9937284-02 96 Well

Monkey Hydroxycarboxylic Acid Receptor 1 (GPR81) ELISA Kit

Sign In for Pricing
View Details