Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine soluble Interleukin 2 Receptor (sIL-2R) ELISA Kit
EIA05878p 1 Kit

Porcine soluble Interleukin 2 Receptor (sIL-2R) ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin-2 Antibody Pair Set
ABPR-ZB376 5 plates, 15 plates

Human Angiopoietin-2 Antibody Pair Set

Sign In for Pricing
View Details
PFKL Overexpression Lysate (Native) - (Dry Ice)
NBL1-14315 0.1 mg

PFKL Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Human Monoclonal Integrin beta 7 Antibody (Genentech patent anti-Integrin beta7) [DyLight 488]
NBP3-28000G 0.1 mL

Human Monoclonal Integrin beta 7 Antibody (Genentech patent anti-Integrin beta7) [DyLight 488]

Sign In for Pricing
View Details
TCEA3 (TFIISH, Transcription Elongation Factor A Protein 3, Transcription Elongation Factor S-II Protein 3, Transcription Elongation Factor TFIIS.h) (MaxLight 550)
134276-ML550 100 µL

TCEA3 (TFIISH, Transcription Elongation Factor A Protein 3, Transcription Elongation Factor S-II Protein 3, Transcription Elongation Factor TFIIS.h) (MaxLight 550)

Sign In for Pricing
View Details
PIAS2, CT (E3 SUMO-protein Ligase PIAS2, Protein Inhibitor of Activated STAT2, Protein Inhibitor of Activated STAT x, Msx-interacting Zinc Finger Protein, Miz1, DAB2-interacting Protein, DIP, Androgen Receptor-interacting Protein 3, ARIP3, PIAS-NY Protein, PIASX) (Biotin) discontinued
P4085-11B-Biotin 200 µL

PIAS2, CT (E3 SUMO-protein Ligase PIAS2, Protein Inhibitor of Activated STAT2, Protein Inhibitor of Activated STAT x, Msx-interacting Zinc Finger Protein, Miz1, DAB2-interacting Protein, DIP, Androgen Receptor-interacting Protein 3, ARIP3, PIAS-NY Protein, PIASX) (Biotin) discontinued

Sign In for Pricing
View Details