Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spike Protein (C-His, SARS-CoV-2)
P519926 100 µg

Spike Protein (C-His, SARS-CoV-2)

Sign In for Pricing
View Details
Semaphorin 3F (SEMA3F) Human shRNA Plasmid Kit (Locus ID 6405)
TL309558 1 Kit

Semaphorin 3F (SEMA3F) Human shRNA Plasmid Kit (Locus ID 6405)

Sign In for Pricing
View Details
Rabbit Polyclonal Wnt16 Antibody [DyLight 650]
NBP2-99324C 0.1 mL

Rabbit Polyclonal Wnt16 Antibody [DyLight 650]

Sign In for Pricing
View Details
Venetoclax-d6
TRC-V121008-10MG 10 mg

Venetoclax-d6

Sign In for Pricing
View Details
LON Peptidase N-Terminal Domain And RING Finger Protein 1 (LONRF1) Antibody
abx146159-01 100 µg

LON Peptidase N-Terminal Domain And RING Finger Protein 1 (LONRF1) Antibody

Sign In for Pricing
View Details
LON Peptidase N-Terminal Domain And RING Finger Protein 1 (LONRF1) Antibody
abx146159-02 1 mg

LON Peptidase N-Terminal Domain And RING Finger Protein 1 (LONRF1) Antibody

Sign In for Pricing
View Details