Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anti-Human IL12B/IL-12 p40/NKSF2 (HAIL-12)
DHD84012 100 μg

Research Grade Anti-Human IL12B/IL-12 p40/NKSF2 (HAIL-12)

Sign In for Pricing
View Details
DMC1 Rabbit pAb
E45R25528N-100 100 µL

DMC1 Rabbit pAb

Sign In for Pricing
View Details
INPP5F (NM_014937) Human Tagged Lenti ORF Clone
RC211091L1 10 µg

INPP5F (NM_014937) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
2,3,4,5,6-Pentafluorostyrene
sc-254323A 25 g

2,3,4,5,6-Pentafluorostyrene

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Golden Syrian Hamster IgG (H+L) Secondary Antibody [Alkaline Phosphatase]
NB120-6893 1 mg

Goat Polyclonal Goat anti-Golden Syrian Hamster IgG (H+L) Secondary Antibody [Alkaline Phosphatase]

Sign In for Pricing
View Details
Human muscarinic receptor (MR) ELISA Kit
YP-W19974-01 48 Tests

Human muscarinic receptor (MR) ELISA Kit

Sign In for Pricing
View Details