Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSUN5C (NSUN5P2, WBSCR20B, WBSCR20C, Putative Methyltransferase NSUN5C, NOL1/NOP2/Sun Domain Family Member 5C, Williams-Beuren Syndrome Chromosomal Region 20C Protein, DKFZp434K058, DKFZp666P104, FLJ11626, MGC129801, MGC15057) (MaxLight 550)
138195-ML550 100 µL

NSUN5C (NSUN5P2, WBSCR20B, WBSCR20C, Putative Methyltransferase NSUN5C, NOL1/NOP2/Sun Domain Family Member 5C, Williams-Beuren Syndrome Chromosomal Region 20C Protein, DKFZp434K058, DKFZp666P104, FLJ11626, MGC129801, MGC15057) (MaxLight 550)

Sign In for Pricing
View Details
Tnfrsf9 Rat shRNA Plasmid (Locus ID 500590)
TL703083 1 Kit

Tnfrsf9 Rat shRNA Plasmid (Locus ID 500590)

Sign In for Pricing
View Details
LOC500625 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6359704 1.0 µg DNA

LOC500625 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
4-Fluoro-3-[ (trifluoromethyl) sulfonyl]benzenesulfonamide
012418 50 mg

4-Fluoro-3-[ (trifluoromethyl) sulfonyl]benzenesulfonamide

Sign In for Pricing
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 20.3 kDa protein in HE65-PK2 intergenic region
MBS1072626-01 0.02 mg (E-Coli)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 20.3 kDa protein in HE65-PK2 intergenic region

Sign In for Pricing
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 20.3 kDa protein in HE65-PK2 intergenic region
MBS1072626-02 0.1 mg (E-Coli)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 20.3 kDa protein in HE65-PK2 intergenic region

Sign In for Pricing
View Details