Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trim66 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6204706 1.0 µg DNA

Trim66 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Olfr23 (NM_010970) Mouse Tagged ORF Clone Lentiviral Particle
MR213232L4V 200 µL

Olfr23 (NM_010970) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal AMFR/gp78 Antibody [Biotin]
NBP2-97986B 0.1 mL

Rabbit Polyclonal AMFR/gp78 Antibody [Biotin]

Sign In for Pricing
View Details
SDAR1 Cells
T8257 1x106 cells / 1.0 mL

SDAR1 Cells

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase TRIM11 (TRIM11) Mouse ELISA Kit
D0820 96 Tests

E3 ubiquitin-protein ligase TRIM11 (TRIM11) Mouse ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal NOXRED1 Antibody [Janelia Fluor 549]
NBP2-99261JF549 0.1 mL

Rabbit Polyclonal NOXRED1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details