Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAL (Galanin Peptides, Galanin, Galanin Message-associated Peptide, GAL1, GALN, GLNN, GMAP, MGC40167) (HRP)
MBS6152617-01 0.1 mL

GAL (Galanin Peptides, Galanin, Galanin Message-associated Peptide, GAL1, GALN, GLNN, GMAP, MGC40167) (HRP)

Sign In for Pricing
View Details
GAL (Galanin Peptides, Galanin, Galanin Message-associated Peptide, GAL1, GALN, GLNN, GMAP, MGC40167) (HRP)
MBS6152617-02 5x 0.1 mL

GAL (Galanin Peptides, Galanin, Galanin Message-associated Peptide, GAL1, GALN, GLNN, GMAP, MGC40167) (HRP)

Sign In for Pricing
View Details
Mouse Complement 1 Inhibitor (C1INH) ELISA Kit-Sandwich
EK5F417-01 48 Test

Mouse Complement 1 Inhibitor (C1INH) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Complement 1 Inhibitor (C1INH) ELISA Kit-Sandwich
EK5F417-02 96 Tests

Mouse Complement 1 Inhibitor (C1INH) ELISA Kit-Sandwich

Sign In for Pricing
View Details
NEUROG3 (Neurogenin 3, Atoh5, Math4B, bHLHa7, ngn3) (MaxLight 650)
249270-ML650 100 µL

NEUROG3 (Neurogenin 3, Atoh5, Math4B, bHLHa7, ngn3) (MaxLight 650)

Sign In for Pricing
View Details
Monoclonal Antibody to Neuregulin 4 (NRG4)
MBS2126662-01 0.1 mL

Monoclonal Antibody to Neuregulin 4 (NRG4)

Sign In for Pricing
View Details