Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccr6 (NM_009835) Mouse Tagged Lenti ORF Clone
MR227479L3 10 µg

Ccr6 (NM_009835) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Chicken Zinc Finger Protein 36, C3H1 Type-Like 1 (ZFP36L1) ELISA Kit
MBS9912716 Inquire

Chicken Zinc Finger Protein 36, C3H1 Type-Like 1 (ZFP36L1) ELISA Kit

Sign In for Pricing
View Details
Mouse Coq4 ELISA KIT
ELI-33894m 96 Tests

Mouse Coq4 ELISA KIT

Sign In for Pricing
View Details
Human C6orf132 activation kit by CRISPRa
GA118796 1 Kit

Human C6orf132 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Polyclonal C19orf57 Antibody [PE]
NBP2-97388PE 0.1 mL

Rabbit Polyclonal C19orf57 Antibody [PE]

Sign In for Pricing
View Details
FGF Receptor 1 (phospho-Tyr653/654) rabbit pAb
UB-GEN-16692 100 µL

FGF Receptor 1 (phospho-Tyr653/654) rabbit pAb

Sign In for Pricing
View Details