Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Cwc15 Plasmid
PVT45013 2 µg

pCMV-SPORT6-Cwc15 Plasmid

Sign In for Pricing
View Details
Mouse monoclonal POMC Antibody (OTI2B2)
NBP2-45369 0.1 mL

Mouse monoclonal POMC Antibody (OTI2B2)

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike RBD (A520S) -His Recombinant Protein
PO55030M2 100 µg

SARS-CoV-2 (2019-nCoV) Spike RBD (A520S) -His Recombinant Protein

Sign In for Pricing
View Details
UBE2D1 Antibody, HRP conjugated
A37860-50UG 50 µg

UBE2D1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Mouse Siglec3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit
FY-EM3523 96 Well

Mouse Siglec3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Bcl-2 beta antibody
SL15534R-01 50 µL

Rabbit Anti-Bcl-2 beta antibody

Sign In for Pricing
View Details