Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp26 (NM_001108995) Rat Untagged Clone
RN214071 10 µg

Zfp26 (NM_001108995) Rat Untagged Clone

Sign In for Pricing
View Details
Rat Mannose Binding Lectin (MBL) ELISA Kit
MBS2703347-01 24 Strip Well

Rat Mannose Binding Lectin (MBL) ELISA Kit

Sign In for Pricing
View Details
Rat Mannose Binding Lectin (MBL) ELISA Kit
MBS2703347-02 48 Well

Rat Mannose Binding Lectin (MBL) ELISA Kit

Sign In for Pricing
View Details
Rat Mannose Binding Lectin (MBL) ELISA Kit
MBS2703347-03 96 Well

Rat Mannose Binding Lectin (MBL) ELISA Kit

Sign In for Pricing
View Details
Rat Mannose Binding Lectin (MBL) ELISA Kit
MBS2703347-04 5x 96 Well

Rat Mannose Binding Lectin (MBL) ELISA Kit

Sign In for Pricing
View Details
Rat Mannose Binding Lectin (MBL) ELISA Kit
MBS2703347-05 10x 96 Well

Rat Mannose Binding Lectin (MBL) ELISA Kit

Sign In for Pricing
View Details