Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHODL, Rat (HEK293, His)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CHODL Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chodl-protein-rat-hek293-his.html

Purity

98.0

Smiles

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Molecular Formula

288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)

Molecular Weight

Approximately 30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Cytochrome P450 4A10 (CYP4A10) ELISA Kit
MBS9398318 Inquire

Cat Cytochrome P450 4A10 (CYP4A10) ELISA Kit

Sign In for Pricing
View Details
Inhibin B (INB) BioAssayTM ELISA Kit (Mouse) discontinued
194782-01 48 Tests

Inhibin B (INB) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Inhibin B (INB) BioAssayTM ELISA Kit (Mouse) discontinued
194782-02 96 Tests

Inhibin B (INB) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Anti-PRKAB2 antibody
STJ25117 100 µl

Anti-PRKAB2 antibody

Sign In for Pricing
View Details
POFUT1 (NM_015352) Human Tagged ORF Clone
RC217185 10 µg

POFUT1 (NM_015352) Human Tagged ORF Clone

Sign In for Pricing
View Details
anti-FMNL1
YF-PA10587 50 ul

anti-FMNL1

Sign In for Pricing
View Details