Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC3, Human (His-SUMO)

APOC3 protein is found in VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates VLDL1 assembly and secretion and assists in lipid transport. APOC3 Protein, Human (His-SUMO) is the recombinant human-derived APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

APOC3 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apoc3-protein-human-his-sumo.html

Purity

97.00

Smiles

SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Molecular Formula

345 (Gene_ID) P02656 (S21-A99) (Accession)

Molecular Weight

Approximately 22-24.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Elab Fluor® 594 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
Human C19orf15 (CATSPERG) activation kit by CRISPRa
GA111744 1 Kit

Human C19orf15 (CATSPERG) activation kit by CRISPRa

Sign In for Pricing
View Details
Human ATHL1 (PGGHG) activation kit by CRISPRa
GA112844 1 Kit

Human ATHL1 (PGGHG) activation kit by CRISPRa

Sign In for Pricing
View Details
TBC1D21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B1]
TA503762AM 100 µL

TBC1D21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B1]

Sign In for Pricing
View Details