Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC3, Human (His-SUMO)

APOC3 protein is found in VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates VLDL1 assembly and secretion and assists in lipid transport. APOC3 Protein, Human (His-SUMO) is the recombinant human-derived APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

APOC3 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apoc3-protein-human-his-sumo.html

Purity

97.00

Smiles

SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Molecular Formula

345 (Gene_ID) P02656 (S21-A99) (Accession)

Molecular Weight

Approximately 22-24.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DP/-DQ/-DR (MHC II) (CR3/43), CF488A conjugate, 0.1mg/mL
BNC881656-500 1x 500 µL

HLA-DP/-DQ/-DR (MHC II) (CR3/43), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF383 Human Gene Knockout Kit (CRISPR)
KN422499 1 Kit

ZNF383 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human LRATD1 activation kit by CRISPRa
GA115791 1 Kit

Human LRATD1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Cacna1e activation kit by CRISPRa
GA200479 1 Kit

Mouse Cacna1e activation kit by CRISPRa

Sign In for Pricing
View Details
Pmch (BC048534) Mouse Tagged ORF Clone
MG201335 10 µg

Pmch (BC048534) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
1,3-distearoyl-2-chloropropanediol-d5 (MAJOR)
TRC-D493514-1MG 1 mg

1,3-distearoyl-2-chloropropanediol-d5 (MAJOR)

Sign In for Pricing
View Details