Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC3, Human (His-SUMO)

APOC3 protein is found in VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates VLDL1 assembly and secretion and assists in lipid transport. APOC3 Protein, Human (His-SUMO) is the recombinant human-derived APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

APOC3 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apoc3-protein-human-his-sumo.html

Purity

97.00

Smiles

SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Molecular Formula

345 (Gene_ID) P02656 (S21-A99) (Accession)

Molecular Weight

Approximately 22-24.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin beta 1 (ITGB1) Human Gene Knockout Kit (CRISPR)
KN203818RB 1 Kit

Integrin beta 1 (ITGB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-500 1x 500 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF214 (N-term) Rabbit Polyclonal Antibody
AP54676PU-N 400 µL

ZNF214 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT5B (STAT5B/2611), CF647 conjugate, 0.1mg/mL
BNC472611-500 1x 500 µL

STAT5B (STAT5B/2611), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary
CP565392 150 µg

Tissue Protein Lysate, Ovary

Sign In for Pricing
View Details
AKIRIN2 Human Gene Knockout Kit (CRISPR)
KN400881 1 Kit

AKIRIN2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details