Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC3, Human (His-SUMO)

APOC3 protein is found in VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates VLDL1 assembly and secretion and assists in lipid transport. APOC3 Protein, Human (His-SUMO) is the recombinant human-derived APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

APOC3 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apoc3-protein-human-his-sumo.html

Purity

97.00

Smiles

SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Molecular Formula

345 (Gene_ID) P02656 (S21-A99) (Accession)

Molecular Weight

Approximately 22-24.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD24 Human Recombinant Protein, Exosome
TP721379M 100 µg

CD24 Human Recombinant Protein, Exosome

Sign In for Pricing
View Details
Recombinant SENP1 Antibody
RN-074-01 50 μL

Recombinant SENP1 Antibody

Sign In for Pricing
View Details
Recombinant SENP1 Antibody
RN-074-02 100 µL

Recombinant SENP1 Antibody

Sign In for Pricing
View Details
Recombinant SENP1 Antibody
RN-074-03 1 mL

Recombinant SENP1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS634633 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB525792 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details