Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC3, Human (His-SUMO)

APOC3 protein is found in VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates VLDL1 assembly and secretion and assists in lipid transport. APOC3 Protein, Human (His-SUMO) is the recombinant human-derived APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

APOC3 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apoc3-protein-human-his-sumo.html

Purity

97.00

Smiles

SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Molecular Formula

345 (Gene_ID) P02656 (S21-A99) (Accession)

Molecular Weight

Approximately 22-24.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human APEG1 (SPEG) activation kit by CRISPRa
GA107011 1 Kit

Human APEG1 (SPEG) activation kit by CRISPRa

Sign In for Pricing
View Details
Rsrp1 Mouse Gene Knockout Kit (CRISPR)
KN515176 1 Kit

Rsrp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rhox3g Mouse Gene Knockout Kit (CRISPR)
KN514796 1 Kit

Rhox3g Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DII (DIIC18 (3) )
#60010 1x 50 mg

DII (DIIC18 (3) )

Sign In for Pricing
View Details
Smg1 Rabbit Polyclonal Antibody
HA500054 100 µL

Smg1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(3beta)-7-Dehydro Cholesterol
TRC-D229455-1G 1 g

(3beta)-7-Dehydro Cholesterol

Sign In for Pricing
View Details