Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC3, Human (His-SUMO)

APOC3 protein is found in VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates VLDL1 assembly and secretion and assists in lipid transport. APOC3 Protein, Human (His-SUMO) is the recombinant human-derived APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

APOC3 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apoc3-protein-human-his-sumo.html

Purity

97.00

Smiles

SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Molecular Formula

345 (Gene_ID) P02656 (S21-A99) (Accession)

Molecular Weight

Approximately 22-24.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC00226 Adenovirus (Human)
26607051 1.0 mL

LINC00226 Adenovirus (Human)

Sign In for Pricing
View Details
BMX (NM_203281) Human Tagged ORF Clone
RC202002 10 µg

BMX (NM_203281) Human Tagged ORF Clone

Sign In for Pricing
View Details
Msx2 Mouse shRNA Lentiviral Particle (Locus ID 17702)
TL501382V 500 µL Each

Msx2 Mouse shRNA Lentiviral Particle (Locus ID 17702)

Sign In for Pricing
View Details
Sheep anti-Gamma-aminobutyric acid receptor subunit beta-2 antibody ELISA Kit
MBS7275346-01 48 Well

Sheep anti-Gamma-aminobutyric acid receptor subunit beta-2 antibody ELISA Kit

Sign In for Pricing
View Details
Sheep anti-Gamma-aminobutyric acid receptor subunit beta-2 antibody ELISA Kit
MBS7275346-02 96 Well

Sheep anti-Gamma-aminobutyric acid receptor subunit beta-2 antibody ELISA Kit

Sign In for Pricing
View Details
Sheep anti-Gamma-aminobutyric acid receptor subunit beta-2 antibody ELISA Kit
MBS7275346-03 5x 96 Well

Sheep anti-Gamma-aminobutyric acid receptor subunit beta-2 antibody ELISA Kit

Sign In for Pricing
View Details