Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (Biotinylated, HEK293, His-Avi)

CD150/SLAMF1 protein is an autoligand receptor in the SLAM family, which can regulate the activation and differentiation of immune cells and affect innate and adaptive immune responses. Its activity depends on the cytoplasmic adapters SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD150/SLAMF1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek-293-his-avi.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

45-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POPDC2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1688508 1.0 µg DNA

POPDC2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal SCGF/CLEC11a Antibody (MM0533-6D5)
NBP2-11874-0.025mg 0.025 mg

Mouse Monoclonal SCGF/CLEC11a Antibody (MM0533-6D5)

Sign In for Pricing
View Details
SNX9 (Sorting Nexin-9, MST155, MSTP155, SDP1, SH3PX1, SH3PXD3A, WISP) (AP)
MBS6438508-01 0.1 mL

SNX9 (Sorting Nexin-9, MST155, MSTP155, SDP1, SH3PX1, SH3PXD3A, WISP) (AP)

Sign In for Pricing
View Details
SNX9 (Sorting Nexin-9, MST155, MSTP155, SDP1, SH3PX1, SH3PXD3A, WISP) (AP)
MBS6438508-02 5x 0.1 mL

SNX9 (Sorting Nexin-9, MST155, MSTP155, SDP1, SH3PX1, SH3PXD3A, WISP) (AP)

Sign In for Pricing
View Details
LentimiRa-hsa-mir-1208 Vector
mh40048 500 ng

LentimiRa-hsa-mir-1208 Vector

Sign In for Pricing
View Details
3-Hydroxy-DL-kynurenine
426003-01 5 mg

3-Hydroxy-DL-kynurenine

Sign In for Pricing
View Details